Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7PVC6

Protein Details
Accession U7PVC6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-28QKLLHRARSLRRLHNHSNPHSSDHydrophilic
299-318ESERYFKRGNWKRRGIVFSAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MLATSQKLLHRARSLRRLHNHSNPHSSDDETLPQMPPSPTQISSPRLFSTSASVEPMTVPMTVSRPIPMPMPPTQRPRTSGHGGIPIAEVDHPHDDHIHYRQASTCSHASRASSSWSSNASTTSSTTSSRNAGLEWDSLRLHPVPCMPMPMPMPMPVVNASPQYYDAGRSFYYEEDADALAATTRGPHGFDFGFDASAPRPSTASRRRAVRQTIADIHLASSAADDEGFEVQGLSAPPPRHHRLRAHQSEANLQQTMRDLQLLGDSGVLDRPSTPPMPALPTSEPASPVTPRTHTAESESERYFKRGNWKRRGIVFSAFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.71
3 0.78
4 0.8
5 0.8
6 0.81
7 0.82
8 0.8
9 0.81
10 0.73
11 0.68
12 0.61
13 0.54
14 0.48
15 0.41
16 0.37
17 0.3
18 0.3
19 0.26
20 0.24
21 0.27
22 0.24
23 0.23
24 0.25
25 0.26
26 0.25
27 0.29
28 0.34
29 0.36
30 0.37
31 0.39
32 0.35
33 0.32
34 0.32
35 0.28
36 0.27
37 0.25
38 0.24
39 0.23
40 0.21
41 0.2
42 0.19
43 0.2
44 0.15
45 0.11
46 0.1
47 0.09
48 0.11
49 0.13
50 0.13
51 0.13
52 0.14
53 0.15
54 0.16
55 0.17
56 0.2
57 0.25
58 0.33
59 0.38
60 0.45
61 0.5
62 0.53
63 0.54
64 0.54
65 0.54
66 0.52
67 0.5
68 0.44
69 0.45
70 0.41
71 0.37
72 0.33
73 0.26
74 0.2
75 0.16
76 0.13
77 0.1
78 0.12
79 0.12
80 0.12
81 0.13
82 0.13
83 0.17
84 0.2
85 0.23
86 0.21
87 0.21
88 0.24
89 0.26
90 0.25
91 0.26
92 0.27
93 0.23
94 0.25
95 0.25
96 0.23
97 0.22
98 0.23
99 0.23
100 0.21
101 0.2
102 0.19
103 0.2
104 0.2
105 0.18
106 0.17
107 0.14
108 0.13
109 0.13
110 0.14
111 0.14
112 0.14
113 0.15
114 0.16
115 0.16
116 0.16
117 0.16
118 0.13
119 0.13
120 0.13
121 0.14
122 0.12
123 0.13
124 0.12
125 0.12
126 0.13
127 0.13
128 0.12
129 0.11
130 0.12
131 0.13
132 0.13
133 0.16
134 0.14
135 0.16
136 0.17
137 0.18
138 0.17
139 0.15
140 0.16
141 0.13
142 0.14
143 0.12
144 0.12
145 0.11
146 0.11
147 0.11
148 0.09
149 0.1
150 0.1
151 0.09
152 0.1
153 0.1
154 0.11
155 0.1
156 0.11
157 0.11
158 0.11
159 0.12
160 0.1
161 0.1
162 0.09
163 0.08
164 0.07
165 0.06
166 0.06
167 0.04
168 0.04
169 0.04
170 0.03
171 0.04
172 0.05
173 0.06
174 0.06
175 0.08
176 0.08
177 0.09
178 0.11
179 0.11
180 0.11
181 0.1
182 0.11
183 0.09
184 0.13
185 0.13
186 0.1
187 0.11
188 0.12
189 0.21
190 0.29
191 0.36
192 0.37
193 0.43
194 0.48
195 0.55
196 0.59
197 0.57
198 0.52
199 0.5
200 0.5
201 0.46
202 0.42
203 0.35
204 0.29
205 0.23
206 0.19
207 0.12
208 0.08
209 0.06
210 0.05
211 0.05
212 0.04
213 0.05
214 0.05
215 0.06
216 0.05
217 0.05
218 0.05
219 0.07
220 0.07
221 0.08
222 0.12
223 0.14
224 0.17
225 0.25
226 0.31
227 0.36
228 0.42
229 0.5
230 0.56
231 0.66
232 0.71
233 0.71
234 0.68
235 0.63
236 0.64
237 0.6
238 0.53
239 0.43
240 0.34
241 0.28
242 0.28
243 0.27
244 0.2
245 0.16
246 0.12
247 0.11
248 0.14
249 0.14
250 0.11
251 0.1
252 0.09
253 0.09
254 0.11
255 0.11
256 0.09
257 0.09
258 0.1
259 0.14
260 0.15
261 0.15
262 0.15
263 0.18
264 0.23
265 0.24
266 0.27
267 0.26
268 0.29
269 0.31
270 0.3
271 0.3
272 0.26
273 0.28
274 0.25
275 0.26
276 0.27
277 0.27
278 0.28
279 0.33
280 0.34
281 0.32
282 0.36
283 0.4
284 0.4
285 0.44
286 0.43
287 0.42
288 0.4
289 0.43
290 0.4
291 0.36
292 0.42
293 0.47
294 0.55
295 0.61
296 0.69
297 0.73
298 0.79
299 0.81
300 0.74
301 0.72