Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7Q7X4

Protein Details
Accession U7Q7X4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
285-309LVRLFRGSLRKRVNKRDRERYLLVRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007849  ATP10  
Pfam View protein in Pfam  
PF05176  ATP-synt_10  
Amino Acid Sequences MATLRIGVATLSRRKGIGALWTLPTPFPSASTPAVIASCVLCQWRTFSTTGRIRRDTKPTIASKAKAGTSTPSAQPEALAEAGAEAKEAAPPKVNALPNAPRSYGKRTDEFTPTPLPRPIGMPAPPMAGENSGIDARTLQQKRDDFVNYEKHLERRKELKTKIVKPYFRDWTNLQFQEGKTFIAPPRLFRSDVSLYFPNLVGQPLLSADKARSKDTEVSTTPIFEQNAATVVAFFSSRWAENQVRTFISPEENPELAEVLAANSGPGKAQLVQINYEDNAMRAWLVRLFRGSLRKRVNKRDRERYLLVRQGVTDDIRENIGLLNSKVGYIYLLDQQCRIRWAGSGSSQPEERQSLAKGVQRLLSEAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.3
4 0.3
5 0.29
6 0.29
7 0.31
8 0.32
9 0.33
10 0.31
11 0.3
12 0.25
13 0.19
14 0.18
15 0.18
16 0.21
17 0.21
18 0.23
19 0.22
20 0.2
21 0.2
22 0.18
23 0.16
24 0.12
25 0.11
26 0.11
27 0.12
28 0.11
29 0.11
30 0.15
31 0.16
32 0.19
33 0.2
34 0.22
35 0.3
36 0.39
37 0.47
38 0.52
39 0.56
40 0.58
41 0.63
42 0.69
43 0.66
44 0.64
45 0.64
46 0.6
47 0.63
48 0.64
49 0.58
50 0.54
51 0.53
52 0.47
53 0.4
54 0.36
55 0.31
56 0.3
57 0.33
58 0.31
59 0.29
60 0.29
61 0.27
62 0.26
63 0.23
64 0.2
65 0.16
66 0.12
67 0.09
68 0.08
69 0.09
70 0.08
71 0.07
72 0.05
73 0.05
74 0.08
75 0.09
76 0.1
77 0.12
78 0.13
79 0.17
80 0.23
81 0.25
82 0.24
83 0.29
84 0.35
85 0.38
86 0.41
87 0.39
88 0.36
89 0.38
90 0.44
91 0.46
92 0.43
93 0.41
94 0.4
95 0.43
96 0.47
97 0.45
98 0.41
99 0.41
100 0.38
101 0.38
102 0.38
103 0.35
104 0.28
105 0.29
106 0.27
107 0.24
108 0.23
109 0.21
110 0.2
111 0.2
112 0.19
113 0.17
114 0.16
115 0.12
116 0.11
117 0.09
118 0.1
119 0.09
120 0.09
121 0.08
122 0.08
123 0.08
124 0.17
125 0.18
126 0.18
127 0.24
128 0.26
129 0.27
130 0.31
131 0.32
132 0.26
133 0.3
134 0.37
135 0.32
136 0.35
137 0.35
138 0.37
139 0.42
140 0.41
141 0.4
142 0.4
143 0.46
144 0.51
145 0.51
146 0.55
147 0.58
148 0.63
149 0.69
150 0.69
151 0.65
152 0.6
153 0.66
154 0.64
155 0.56
156 0.51
157 0.43
158 0.41
159 0.45
160 0.41
161 0.35
162 0.3
163 0.29
164 0.29
165 0.28
166 0.21
167 0.14
168 0.16
169 0.15
170 0.21
171 0.21
172 0.2
173 0.25
174 0.27
175 0.28
176 0.25
177 0.31
178 0.26
179 0.27
180 0.29
181 0.25
182 0.23
183 0.23
184 0.22
185 0.17
186 0.13
187 0.12
188 0.08
189 0.06
190 0.06
191 0.06
192 0.07
193 0.06
194 0.06
195 0.07
196 0.13
197 0.15
198 0.16
199 0.16
200 0.19
201 0.25
202 0.26
203 0.31
204 0.26
205 0.28
206 0.26
207 0.26
208 0.24
209 0.21
210 0.19
211 0.14
212 0.13
213 0.1
214 0.11
215 0.1
216 0.09
217 0.06
218 0.06
219 0.06
220 0.06
221 0.05
222 0.06
223 0.07
224 0.08
225 0.09
226 0.15
227 0.17
228 0.21
229 0.25
230 0.26
231 0.26
232 0.26
233 0.26
234 0.22
235 0.23
236 0.2
237 0.2
238 0.22
239 0.21
240 0.2
241 0.19
242 0.18
243 0.14
244 0.14
245 0.1
246 0.05
247 0.05
248 0.05
249 0.05
250 0.04
251 0.05
252 0.05
253 0.05
254 0.06
255 0.07
256 0.11
257 0.15
258 0.16
259 0.18
260 0.19
261 0.21
262 0.19
263 0.2
264 0.16
265 0.13
266 0.11
267 0.09
268 0.09
269 0.07
270 0.08
271 0.11
272 0.12
273 0.13
274 0.14
275 0.16
276 0.21
277 0.3
278 0.33
279 0.39
280 0.49
281 0.57
282 0.64
283 0.74
284 0.8
285 0.81
286 0.87
287 0.89
288 0.86
289 0.84
290 0.82
291 0.79
292 0.78
293 0.74
294 0.67
295 0.57
296 0.5
297 0.43
298 0.4
299 0.32
300 0.25
301 0.18
302 0.16
303 0.16
304 0.16
305 0.14
306 0.12
307 0.14
308 0.14
309 0.13
310 0.16
311 0.15
312 0.15
313 0.15
314 0.13
315 0.12
316 0.1
317 0.12
318 0.16
319 0.2
320 0.21
321 0.24
322 0.27
323 0.29
324 0.3
325 0.29
326 0.22
327 0.21
328 0.25
329 0.27
330 0.29
331 0.35
332 0.35
333 0.38
334 0.39
335 0.38
336 0.38
337 0.36
338 0.33
339 0.29
340 0.28
341 0.29
342 0.33
343 0.37
344 0.36
345 0.36
346 0.38
347 0.36
348 0.37