Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7PRN7

Protein Details
Accession U7PRN7    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSARASSRKNNNQKLKKNVFGPHydrophilic
87-113AILKKPLGKKRIEKRRAKKGSIVFPKYBasic
NLS Segment(s)
PositionSequence
90-122KKPLGKKRIEKRRAKKGSIVFPKYKDRTSKRRK
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARASSRKNNNQKLKKNVFGPVESARTERLSAKLMELAAQPAPVKEAKEDPNAMEDVADADEEPTPSDQLKEEASAAMEVDSGAILKKPLGKKRIEKRRAKKGSIVFPKYKDRTSKRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.9
3 0.91
4 0.88
5 0.84
6 0.77
7 0.74
8 0.68
9 0.58
10 0.53
11 0.47
12 0.42
13 0.36
14 0.33
15 0.28
16 0.25
17 0.25
18 0.22
19 0.2
20 0.19
21 0.18
22 0.18
23 0.18
24 0.17
25 0.17
26 0.15
27 0.15
28 0.12
29 0.12
30 0.11
31 0.09
32 0.11
33 0.1
34 0.1
35 0.1
36 0.14
37 0.17
38 0.21
39 0.22
40 0.2
41 0.21
42 0.21
43 0.19
44 0.14
45 0.11
46 0.07
47 0.07
48 0.06
49 0.04
50 0.04
51 0.05
52 0.05
53 0.06
54 0.05
55 0.06
56 0.06
57 0.07
58 0.07
59 0.08
60 0.08
61 0.09
62 0.09
63 0.08
64 0.09
65 0.08
66 0.08
67 0.06
68 0.06
69 0.05
70 0.04
71 0.04
72 0.03
73 0.04
74 0.04
75 0.04
76 0.05
77 0.12
78 0.19
79 0.26
80 0.33
81 0.4
82 0.5
83 0.6
84 0.71
85 0.75
86 0.79
87 0.82
88 0.87
89 0.89
90 0.84
91 0.82
92 0.8
93 0.8
94 0.8
95 0.78
96 0.74
97 0.7
98 0.75
99 0.72
100 0.7
101 0.69
102 0.68