Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7Q5D5

Protein Details
Accession U7Q5D5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
180-201GDGDRNRHPRRHRYSVGFLCDKBasic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto 6, cysk 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000014  PAS  
IPR035965  PAS-like_dom_sf  
Pfam View protein in Pfam  
PF13426  PAS_9  
PROSITE View protein in PROSITE  
PS50112  PAS  
CDD cd00130  PAS  
Amino Acid Sequences MVMALAPATLERETSAQDAVDQEPALAYDSNLFFFPGMYCPSGFDLMKILYCVVARPHPAIDLGPVDASCPIVLCDLYLPDTPIVYASHSFLALTGYSLDEVLGRNCRFLQWPGTVQEPTVPPTAPSTPSPYVQPAVRQLLHQSVKHNREMQLEVNNFRKDGSAFVNFLSVVPIYWDDGGDGDRNRHPRRHRYSVGFLCDKTAME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.12
4 0.13
5 0.15
6 0.15
7 0.16
8 0.14
9 0.12
10 0.11
11 0.12
12 0.13
13 0.1
14 0.09
15 0.11
16 0.12
17 0.13
18 0.13
19 0.13
20 0.11
21 0.11
22 0.12
23 0.1
24 0.12
25 0.12
26 0.12
27 0.14
28 0.16
29 0.19
30 0.18
31 0.15
32 0.16
33 0.15
34 0.15
35 0.14
36 0.12
37 0.1
38 0.1
39 0.11
40 0.11
41 0.14
42 0.15
43 0.16
44 0.17
45 0.16
46 0.17
47 0.16
48 0.15
49 0.12
50 0.11
51 0.1
52 0.09
53 0.09
54 0.08
55 0.08
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.08
65 0.08
66 0.09
67 0.08
68 0.08
69 0.08
70 0.09
71 0.08
72 0.07
73 0.08
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.07
80 0.06
81 0.06
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.05
89 0.06
90 0.11
91 0.11
92 0.11
93 0.11
94 0.12
95 0.14
96 0.15
97 0.18
98 0.15
99 0.18
100 0.19
101 0.22
102 0.21
103 0.19
104 0.21
105 0.17
106 0.17
107 0.16
108 0.14
109 0.12
110 0.15
111 0.17
112 0.16
113 0.16
114 0.21
115 0.21
116 0.22
117 0.24
118 0.23
119 0.23
120 0.22
121 0.23
122 0.21
123 0.25
124 0.24
125 0.23
126 0.23
127 0.29
128 0.33
129 0.32
130 0.33
131 0.38
132 0.41
133 0.46
134 0.48
135 0.42
136 0.42
137 0.44
138 0.41
139 0.4
140 0.4
141 0.39
142 0.42
143 0.39
144 0.35
145 0.32
146 0.3
147 0.22
148 0.21
149 0.22
150 0.19
151 0.19
152 0.19
153 0.2
154 0.19
155 0.18
156 0.17
157 0.12
158 0.08
159 0.09
160 0.1
161 0.1
162 0.1
163 0.1
164 0.08
165 0.09
166 0.11
167 0.13
168 0.14
169 0.16
170 0.22
171 0.32
172 0.36
173 0.44
174 0.52
175 0.59
176 0.67
177 0.73
178 0.77
179 0.76
180 0.81
181 0.81
182 0.81
183 0.76
184 0.66
185 0.59