Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2AYQ3

Protein Details
Accession B2AYQ3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-39SDASSVDSRGRRRRRNNKQLAQAGGHydrophilic
NLS Segment(s)
PositionSequence
25-29RRRRR
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
KEGG pan:PODANSg5889  -  
Amino Acid Sequences MASNPVMPKLDDSASDASSVDSRGRRRRRNNKQLAQAGGLSNPAVLPRLADTKPVRLQLGLNLDVEVELKARLQGDVSLTLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.18
4 0.15
5 0.15
6 0.15
7 0.15
8 0.17
9 0.24
10 0.34
11 0.43
12 0.52
13 0.63
14 0.73
15 0.81
16 0.87
17 0.91
18 0.89
19 0.89
20 0.85
21 0.76
22 0.66
23 0.56
24 0.45
25 0.34
26 0.26
27 0.16
28 0.1
29 0.08
30 0.06
31 0.05
32 0.04
33 0.05
34 0.06
35 0.1
36 0.11
37 0.17
38 0.19
39 0.25
40 0.29
41 0.31
42 0.3
43 0.26
44 0.27
45 0.25
46 0.3
47 0.24
48 0.21
49 0.19
50 0.18
51 0.17
52 0.17
53 0.12
54 0.07
55 0.06
56 0.06
57 0.08
58 0.08
59 0.09
60 0.09
61 0.11
62 0.13