Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U7PM00

Protein Details
Accession U7PM00    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
76-102VSLRPKPKGPAPRRRPHRYRTVVKVAVHydrophilic
NLS Segment(s)
PositionSequence
79-93RPKPKGPAPRRRPHR
Subcellular Location(s) mito 17, extr 7, cyto 2
Family & Domain DBs
Amino Acid Sequences MLCLALDPVGGIVARKRQLRVLRLAGLQVQLLKRDESLKRPSGYNTFGRRYVVHLNDSVASGVNAPSIGASTKAEVSLRPKPKGPAPRRRPHRYRTVVKVAVAGIDARDILDLQAPWY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.25
4 0.32
5 0.4
6 0.45
7 0.5
8 0.49
9 0.48
10 0.46
11 0.46
12 0.4
13 0.34
14 0.29
15 0.24
16 0.19
17 0.18
18 0.18
19 0.17
20 0.16
21 0.21
22 0.23
23 0.26
24 0.33
25 0.35
26 0.36
27 0.37
28 0.39
29 0.37
30 0.39
31 0.4
32 0.4
33 0.37
34 0.37
35 0.37
36 0.34
37 0.34
38 0.36
39 0.3
40 0.25
41 0.23
42 0.22
43 0.21
44 0.21
45 0.17
46 0.1
47 0.08
48 0.06
49 0.06
50 0.05
51 0.04
52 0.04
53 0.03
54 0.04
55 0.04
56 0.05
57 0.05
58 0.06
59 0.06
60 0.07
61 0.08
62 0.09
63 0.15
64 0.23
65 0.29
66 0.3
67 0.33
68 0.36
69 0.43
70 0.52
71 0.57
72 0.59
73 0.63
74 0.71
75 0.79
76 0.86
77 0.87
78 0.84
79 0.85
80 0.83
81 0.82
82 0.81
83 0.81
84 0.74
85 0.67
86 0.61
87 0.5
88 0.41
89 0.33
90 0.24
91 0.14
92 0.1
93 0.09
94 0.07
95 0.07
96 0.07
97 0.07
98 0.1