Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2AET8

Protein Details
Accession B2AET8   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-81REGERGRERGRERKRERERERERLRVRBasic
NLS Segment(s)
PositionSequence
49-81RGGEREREGERGRERGRERKRERERERERLRVR
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 6.5, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036881  Glyco_hydro_3_C_sf  
IPR013783  Ig-like_fold  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
KEGG pan:PODANSg1194  -  
Amino Acid Sequences MAVSYILSHMPGTDHMPSTGRGLGSRARSAQGKGEQSPCRQSMEKEGERGGEREREGERGRERGRERKRERERERERLRVRLPGSESSGKLTVSFPYSVGDLPVYYDYWNSGRGPSLNSGVSYENGTLVFGRQYVLGDLRPLYEFGYGRSYSIFVYSDVAVDKQEVRERDIITISVTVKNTSERDGKEVLQLYVKDLIASVDLRVWNSRIKYVVEPGDFMLIVGASSNDSKDNITITLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.2
4 0.2
5 0.23
6 0.24
7 0.21
8 0.18
9 0.19
10 0.24
11 0.27
12 0.3
13 0.29
14 0.29
15 0.32
16 0.33
17 0.38
18 0.4
19 0.4
20 0.41
21 0.47
22 0.49
23 0.51
24 0.56
25 0.5
26 0.48
27 0.44
28 0.41
29 0.43
30 0.47
31 0.46
32 0.42
33 0.42
34 0.41
35 0.41
36 0.4
37 0.34
38 0.29
39 0.26
40 0.27
41 0.27
42 0.29
43 0.3
44 0.35
45 0.36
46 0.39
47 0.41
48 0.45
49 0.5
50 0.54
51 0.62
52 0.65
53 0.69
54 0.72
55 0.8
56 0.83
57 0.86
58 0.87
59 0.87
60 0.86
61 0.87
62 0.86
63 0.79
64 0.77
65 0.71
66 0.67
67 0.59
68 0.54
69 0.49
70 0.42
71 0.43
72 0.38
73 0.36
74 0.31
75 0.31
76 0.25
77 0.22
78 0.19
79 0.15
80 0.14
81 0.14
82 0.11
83 0.1
84 0.11
85 0.1
86 0.1
87 0.09
88 0.06
89 0.07
90 0.07
91 0.07
92 0.06
93 0.07
94 0.07
95 0.08
96 0.1
97 0.09
98 0.09
99 0.09
100 0.1
101 0.12
102 0.12
103 0.13
104 0.12
105 0.12
106 0.13
107 0.12
108 0.12
109 0.11
110 0.1
111 0.08
112 0.08
113 0.08
114 0.06
115 0.06
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.06
122 0.07
123 0.07
124 0.07
125 0.08
126 0.08
127 0.08
128 0.09
129 0.08
130 0.1
131 0.1
132 0.11
133 0.15
134 0.14
135 0.14
136 0.14
137 0.14
138 0.12
139 0.13
140 0.12
141 0.08
142 0.1
143 0.09
144 0.1
145 0.1
146 0.1
147 0.08
148 0.09
149 0.09
150 0.11
151 0.15
152 0.15
153 0.18
154 0.22
155 0.23
156 0.24
157 0.24
158 0.21
159 0.18
160 0.2
161 0.18
162 0.17
163 0.17
164 0.16
165 0.16
166 0.19
167 0.19
168 0.21
169 0.25
170 0.22
171 0.26
172 0.28
173 0.28
174 0.3
175 0.32
176 0.28
177 0.27
178 0.26
179 0.24
180 0.26
181 0.25
182 0.19
183 0.17
184 0.16
185 0.13
186 0.13
187 0.11
188 0.11
189 0.12
190 0.13
191 0.15
192 0.16
193 0.2
194 0.21
195 0.24
196 0.23
197 0.26
198 0.28
199 0.33
200 0.38
201 0.34
202 0.34
203 0.31
204 0.31
205 0.27
206 0.24
207 0.17
208 0.1
209 0.09
210 0.08
211 0.07
212 0.06
213 0.07
214 0.08
215 0.09
216 0.1
217 0.12
218 0.12
219 0.14