Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7PKI7

Protein Details
Accession U7PKI7   
Localization Confidence High
Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
83-109KTPRTPRTPRTPNTPRKPRKTKGTTAVHydrophilic
128-148APLTPPKSAKRRKTNTGKAVSHydrophilic
NLS Segment(s)
PositionSequence
91-103PRTPNTPRKPRKT
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MEDTAAQDVATDTTSAPGFPDPSPQEAMFFFNMIKNMNNQPDIDWDGVATDSGFKNAAVAKKRFYQIKQKLGLDSRTNTAVVKTPRTPRTPRTPNTPRKPRKTKGTTAVAVSAASDAADADNEDTEAAPLTPPKSAKRRKTNTGKAVSMELSEANVKKLRDVKLEANSEATPEATPKASPEPATDKKQGRSPLPFHRAQQRTPSASVSGSEDKNLANAEDKGVAGHCVDDVMLDSITVTPPRVKCHGDELIKDESEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.12
5 0.14
6 0.13
7 0.22
8 0.23
9 0.26
10 0.31
11 0.29
12 0.29
13 0.27
14 0.31
15 0.23
16 0.21
17 0.18
18 0.16
19 0.17
20 0.17
21 0.17
22 0.18
23 0.24
24 0.28
25 0.29
26 0.27
27 0.26
28 0.3
29 0.32
30 0.28
31 0.21
32 0.16
33 0.15
34 0.14
35 0.13
36 0.09
37 0.08
38 0.08
39 0.09
40 0.09
41 0.08
42 0.1
43 0.13
44 0.19
45 0.24
46 0.26
47 0.28
48 0.34
49 0.39
50 0.44
51 0.45
52 0.5
53 0.52
54 0.6
55 0.63
56 0.59
57 0.6
58 0.59
59 0.6
60 0.53
61 0.46
62 0.39
63 0.33
64 0.32
65 0.26
66 0.23
67 0.23
68 0.21
69 0.24
70 0.28
71 0.34
72 0.4
73 0.46
74 0.5
75 0.51
76 0.59
77 0.63
78 0.61
79 0.64
80 0.68
81 0.73
82 0.78
83 0.83
84 0.81
85 0.83
86 0.89
87 0.85
88 0.86
89 0.83
90 0.8
91 0.77
92 0.76
93 0.67
94 0.58
95 0.53
96 0.42
97 0.34
98 0.26
99 0.17
100 0.09
101 0.07
102 0.05
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.04
116 0.05
117 0.05
118 0.07
119 0.09
120 0.14
121 0.24
122 0.32
123 0.42
124 0.52
125 0.58
126 0.67
127 0.76
128 0.81
129 0.8
130 0.78
131 0.7
132 0.6
133 0.55
134 0.45
135 0.35
136 0.25
137 0.16
138 0.11
139 0.12
140 0.11
141 0.11
142 0.14
143 0.13
144 0.16
145 0.22
146 0.24
147 0.26
148 0.3
149 0.33
150 0.38
151 0.41
152 0.38
153 0.36
154 0.33
155 0.29
156 0.25
157 0.19
158 0.12
159 0.1
160 0.11
161 0.08
162 0.08
163 0.1
164 0.14
165 0.15
166 0.16
167 0.19
168 0.26
169 0.32
170 0.38
171 0.44
172 0.45
173 0.46
174 0.51
175 0.53
176 0.5
177 0.52
178 0.52
179 0.55
180 0.57
181 0.57
182 0.55
183 0.6
184 0.58
185 0.54
186 0.57
187 0.54
188 0.52
189 0.5
190 0.48
191 0.4
192 0.36
193 0.34
194 0.3
195 0.28
196 0.24
197 0.23
198 0.21
199 0.2
200 0.21
201 0.2
202 0.15
203 0.13
204 0.13
205 0.14
206 0.15
207 0.15
208 0.14
209 0.14
210 0.14
211 0.1
212 0.1
213 0.08
214 0.07
215 0.07
216 0.06
217 0.07
218 0.08
219 0.08
220 0.07
221 0.08
222 0.08
223 0.1
224 0.11
225 0.11
226 0.16
227 0.18
228 0.24
229 0.29
230 0.31
231 0.32
232 0.39
233 0.47
234 0.46
235 0.48
236 0.47
237 0.48