Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U7PRC9

Protein Details
Accession U7PRC9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
356-385TTALGVKKSNSRAKREKKPLPPVGKTARKTHydrophilic
NLS Segment(s)
PositionSequence
362-388KKSNSRAKREKKPLPPVGKTARKTRSQ
Subcellular Location(s) cyto 14, cyto_nucl 11.5, mito 6, nucl 5
Family & Domain DBs
Amino Acid Sequences MADFSSAPVGNSDSSERPTNNSAPKPSLETAKLSSLPDLSLPPKPVFVEGSTTGNNASGALNPDSNAAAKKDDSPSSSVGGGLFNGSTAVTDKKDSTDFAKPVTPVSEANGGIDTFHSASGGGNGSSDNKPTTAPLPLIDEAPAEKPGPSEPTATSSVPTASAPSVTLIAPTAPTTNGSAVPSLPSGLPPKPAEPSAPSQAVAPAESVTSGNAIVGEKRKADEAADDKSAAAAPEASAPAPVSSLFGGSAATSSSLPAKPLAATVESADDSEDGASAAKKLKTDTKAETATAADAAPTSTPAAPPVEVPAPSPVTVATPAADPITAPVGAPAGVAPALEVNLGPAPSADKIASTSTTALGVKKSNSRAKREKKPLPPVGKTARKTRSQGPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.28
4 0.31
5 0.36
6 0.42
7 0.46
8 0.5
9 0.52
10 0.51
11 0.52
12 0.54
13 0.51
14 0.5
15 0.44
16 0.41
17 0.39
18 0.4
19 0.41
20 0.35
21 0.34
22 0.28
23 0.26
24 0.23
25 0.23
26 0.21
27 0.23
28 0.26
29 0.25
30 0.27
31 0.27
32 0.27
33 0.26
34 0.24
35 0.25
36 0.23
37 0.27
38 0.25
39 0.25
40 0.23
41 0.21
42 0.19
43 0.14
44 0.13
45 0.1
46 0.13
47 0.15
48 0.15
49 0.15
50 0.16
51 0.16
52 0.16
53 0.16
54 0.14
55 0.14
56 0.15
57 0.19
58 0.23
59 0.25
60 0.27
61 0.28
62 0.28
63 0.28
64 0.27
65 0.23
66 0.18
67 0.16
68 0.13
69 0.11
70 0.09
71 0.06
72 0.06
73 0.06
74 0.06
75 0.07
76 0.09
77 0.1
78 0.12
79 0.13
80 0.15
81 0.16
82 0.18
83 0.21
84 0.26
85 0.26
86 0.27
87 0.3
88 0.28
89 0.28
90 0.28
91 0.25
92 0.17
93 0.19
94 0.22
95 0.18
96 0.18
97 0.18
98 0.16
99 0.14
100 0.14
101 0.13
102 0.08
103 0.08
104 0.07
105 0.06
106 0.06
107 0.08
108 0.09
109 0.07
110 0.07
111 0.07
112 0.11
113 0.11
114 0.13
115 0.12
116 0.11
117 0.12
118 0.13
119 0.14
120 0.13
121 0.13
122 0.13
123 0.16
124 0.16
125 0.17
126 0.15
127 0.14
128 0.13
129 0.13
130 0.14
131 0.1
132 0.09
133 0.09
134 0.1
135 0.14
136 0.14
137 0.15
138 0.14
139 0.18
140 0.21
141 0.21
142 0.2
143 0.16
144 0.15
145 0.14
146 0.13
147 0.1
148 0.07
149 0.07
150 0.07
151 0.07
152 0.08
153 0.07
154 0.07
155 0.06
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.07
162 0.07
163 0.08
164 0.09
165 0.09
166 0.09
167 0.09
168 0.09
169 0.09
170 0.08
171 0.07
172 0.08
173 0.1
174 0.11
175 0.14
176 0.14
177 0.16
178 0.17
179 0.17
180 0.17
181 0.17
182 0.2
183 0.2
184 0.2
185 0.19
186 0.18
187 0.19
188 0.17
189 0.15
190 0.11
191 0.07
192 0.06
193 0.07
194 0.06
195 0.05
196 0.05
197 0.05
198 0.04
199 0.04
200 0.05
201 0.06
202 0.09
203 0.1
204 0.1
205 0.11
206 0.12
207 0.12
208 0.12
209 0.15
210 0.16
211 0.18
212 0.18
213 0.18
214 0.17
215 0.17
216 0.17
217 0.12
218 0.09
219 0.06
220 0.05
221 0.06
222 0.07
223 0.06
224 0.06
225 0.07
226 0.06
227 0.07
228 0.06
229 0.06
230 0.05
231 0.06
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.04
238 0.05
239 0.05
240 0.05
241 0.09
242 0.09
243 0.1
244 0.1
245 0.11
246 0.1
247 0.11
248 0.12
249 0.1
250 0.1
251 0.1
252 0.11
253 0.11
254 0.1
255 0.1
256 0.08
257 0.08
258 0.07
259 0.06
260 0.05
261 0.05
262 0.05
263 0.06
264 0.11
265 0.12
266 0.13
267 0.15
268 0.23
269 0.27
270 0.32
271 0.36
272 0.38
273 0.39
274 0.39
275 0.38
276 0.31
277 0.27
278 0.22
279 0.17
280 0.1
281 0.08
282 0.08
283 0.06
284 0.06
285 0.08
286 0.07
287 0.08
288 0.1
289 0.11
290 0.11
291 0.11
292 0.14
293 0.16
294 0.15
295 0.16
296 0.19
297 0.2
298 0.19
299 0.19
300 0.16
301 0.14
302 0.15
303 0.15
304 0.11
305 0.1
306 0.1
307 0.1
308 0.1
309 0.08
310 0.08
311 0.1
312 0.09
313 0.08
314 0.08
315 0.08
316 0.08
317 0.08
318 0.07
319 0.06
320 0.06
321 0.06
322 0.05
323 0.05
324 0.06
325 0.06
326 0.06
327 0.06
328 0.08
329 0.08
330 0.08
331 0.07
332 0.1
333 0.1
334 0.13
335 0.11
336 0.1
337 0.12
338 0.15
339 0.16
340 0.15
341 0.16
342 0.15
343 0.18
344 0.18
345 0.18
346 0.19
347 0.21
348 0.24
349 0.3
350 0.38
351 0.45
352 0.51
353 0.6
354 0.68
355 0.75
356 0.82
357 0.85
358 0.87
359 0.88
360 0.91
361 0.91
362 0.91
363 0.86
364 0.85
365 0.84
366 0.84
367 0.79
368 0.78
369 0.76
370 0.74
371 0.73