Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U7Q0R6

Protein Details
Accession U7Q0R6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-81MIRSNRKKSSKAKAAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
65-81NRKKSSKAKAAAAKKKA
Subcellular Location(s) plas 21, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLVAASVVFLYYTIWALLMPFVDADHPLQNFFPPRVWAIRIPVILILLGSAVVGTFLSIVMIRSNRKKSSKAKAAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.06
6 0.05
7 0.05
8 0.05
9 0.05
10 0.06
11 0.08
12 0.1
13 0.1
14 0.11
15 0.11
16 0.13
17 0.15
18 0.15
19 0.15
20 0.13
21 0.15
22 0.16
23 0.18
24 0.17
25 0.18
26 0.21
27 0.2
28 0.18
29 0.17
30 0.15
31 0.12
32 0.1
33 0.07
34 0.03
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.04
47 0.07
48 0.1
49 0.15
50 0.23
51 0.31
52 0.38
53 0.43
54 0.51
55 0.58
56 0.66
57 0.71
58 0.7
59 0.72
60 0.75
61 0.81