Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U7Q606

Protein Details
Accession U7Q606    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
331-352KEEPPTTKRTRAPPQKAARGGTHydrophilic
NLS Segment(s)
PositionSequence
237-257RGTRRGKREASKAKKPSTRRG
337-374TKRTRAPPQKAARGGTRGRGAARGRGRGRGRGARGRGR
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012423  Eaf7/MRGBP  
Gene Ontology GO:0043189  C:H4/H2A histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF07904  Eaf7  
Amino Acid Sequences MPPKKRGRGSAVQSAATPSRDDDAMDIDTPQASETPAASAPPDKPIYDVLQSCWTSEQKAGLFSAVIRWKPSGMHRHFRMIAISEHLRCRGFDPDVYQHTRIPGIWKELAAEYELETINDRDNSLDYVEEADVESRFKEFCLPLVDFRDDMMERALADEDDDSAASSPAQWRPESPAPTSRGGAASGGQSVAAPASTSKSSAIKRKRGDMSVLRMRSSTVDSFELASSVPSPAATGRGTRRGKREASKAKKPSTRRGGGDEEEEEEGPEEEEEEVGEEEESGSGGDEENEGEEVDDEEQDEEDGEEEDDEDDNDDDDDDEEEEEEEEEKEKEEPPTTKRTRAPPQKAARGGTRGRGAARGRGRGRGRGARGRGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.47
3 0.38
4 0.32
5 0.23
6 0.21
7 0.2
8 0.2
9 0.16
10 0.17
11 0.18
12 0.18
13 0.17
14 0.15
15 0.15
16 0.14
17 0.14
18 0.1
19 0.08
20 0.09
21 0.09
22 0.11
23 0.11
24 0.12
25 0.13
26 0.16
27 0.16
28 0.22
29 0.24
30 0.21
31 0.22
32 0.25
33 0.28
34 0.3
35 0.3
36 0.27
37 0.33
38 0.33
39 0.32
40 0.33
41 0.31
42 0.26
43 0.27
44 0.28
45 0.21
46 0.23
47 0.22
48 0.19
49 0.18
50 0.16
51 0.22
52 0.22
53 0.22
54 0.22
55 0.23
56 0.23
57 0.26
58 0.33
59 0.37
60 0.39
61 0.48
62 0.49
63 0.56
64 0.57
65 0.55
66 0.5
67 0.42
68 0.36
69 0.32
70 0.33
71 0.28
72 0.29
73 0.31
74 0.29
75 0.27
76 0.27
77 0.27
78 0.24
79 0.23
80 0.26
81 0.31
82 0.37
83 0.41
84 0.41
85 0.36
86 0.36
87 0.35
88 0.29
89 0.28
90 0.24
91 0.25
92 0.24
93 0.23
94 0.23
95 0.23
96 0.22
97 0.18
98 0.15
99 0.1
100 0.12
101 0.12
102 0.1
103 0.11
104 0.11
105 0.12
106 0.12
107 0.11
108 0.09
109 0.1
110 0.11
111 0.1
112 0.1
113 0.08
114 0.09
115 0.09
116 0.08
117 0.08
118 0.08
119 0.07
120 0.08
121 0.08
122 0.07
123 0.07
124 0.07
125 0.1
126 0.1
127 0.12
128 0.16
129 0.17
130 0.2
131 0.24
132 0.25
133 0.21
134 0.21
135 0.21
136 0.17
137 0.16
138 0.14
139 0.1
140 0.09
141 0.1
142 0.1
143 0.06
144 0.06
145 0.06
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.04
153 0.05
154 0.07
155 0.1
156 0.12
157 0.12
158 0.13
159 0.2
160 0.25
161 0.28
162 0.27
163 0.31
164 0.32
165 0.34
166 0.33
167 0.27
168 0.22
169 0.2
170 0.18
171 0.12
172 0.09
173 0.07
174 0.07
175 0.06
176 0.05
177 0.05
178 0.04
179 0.03
180 0.03
181 0.03
182 0.05
183 0.05
184 0.06
185 0.07
186 0.12
187 0.15
188 0.24
189 0.32
190 0.39
191 0.41
192 0.48
193 0.51
194 0.48
195 0.52
196 0.48
197 0.49
198 0.49
199 0.48
200 0.41
201 0.37
202 0.35
203 0.3
204 0.28
205 0.2
206 0.14
207 0.14
208 0.14
209 0.15
210 0.14
211 0.13
212 0.1
213 0.09
214 0.07
215 0.07
216 0.06
217 0.05
218 0.05
219 0.05
220 0.08
221 0.08
222 0.11
223 0.14
224 0.24
225 0.3
226 0.34
227 0.4
228 0.44
229 0.5
230 0.53
231 0.6
232 0.62
233 0.66
234 0.72
235 0.74
236 0.76
237 0.77
238 0.77
239 0.77
240 0.76
241 0.74
242 0.66
243 0.64
244 0.61
245 0.55
246 0.53
247 0.43
248 0.35
249 0.29
250 0.26
251 0.2
252 0.15
253 0.13
254 0.1
255 0.09
256 0.07
257 0.06
258 0.06
259 0.05
260 0.06
261 0.06
262 0.06
263 0.06
264 0.05
265 0.05
266 0.05
267 0.05
268 0.04
269 0.04
270 0.04
271 0.04
272 0.05
273 0.05
274 0.05
275 0.06
276 0.06
277 0.06
278 0.06
279 0.06
280 0.07
281 0.07
282 0.07
283 0.07
284 0.07
285 0.07
286 0.07
287 0.07
288 0.06
289 0.06
290 0.06
291 0.06
292 0.06
293 0.06
294 0.07
295 0.07
296 0.07
297 0.08
298 0.07
299 0.08
300 0.08
301 0.07
302 0.07
303 0.07
304 0.08
305 0.07
306 0.08
307 0.08
308 0.08
309 0.08
310 0.08
311 0.08
312 0.08
313 0.09
314 0.09
315 0.1
316 0.11
317 0.13
318 0.16
319 0.22
320 0.27
321 0.3
322 0.41
323 0.46
324 0.53
325 0.57
326 0.63
327 0.68
328 0.74
329 0.78
330 0.78
331 0.83
332 0.84
333 0.84
334 0.79
335 0.76
336 0.73
337 0.67
338 0.64
339 0.59
340 0.53
341 0.48
342 0.51
343 0.46
344 0.47
345 0.5
346 0.53
347 0.5
348 0.57
349 0.6
350 0.6
351 0.66
352 0.66
353 0.67
354 0.67