Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U7PQD9

Protein Details
Accession U7PQD9    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-32EVKQTPNRRKPGAGNRRPNRKNYASHydrophilic
83-102ASGKAGSRNNRNQQNNNPNSHydrophilic
NLS Segment(s)
PositionSequence
15-27RRKPGAGNRRPNR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MPDPPPTEVKQTPNRRKPGAGNRRPNRKNYASENDVAKADPTFQPDFAHDKKKNNNGRGPSTPQKTQKNAVSSKSPAPASQAASGKAGSRNNRNQQNNNPNSPSAKPGRRTPPHTVGPKPAGAAGSVAAFAGATFHASPAPSSLPLPSFFTKADSPGTPSARPLSGLSQQPSPPASDTELPSATATNAADAPSAARRNPLLPTGGSGIPHARDESPLDILFRADRAEKERNRRASSANIYGAPVGPFSPPFQSQAMADNSNGNTFPRDLAQHQQQQSTRRPGPTLRNSNSGISAAELDGTPGQPMGPAFATPFQDRIRAARPAESNGTSGPGTPGGFRDLAAGTAPSPLAGVPYNQQLPAASVDDRSEALKRFLFSKTGASAPSPPVHPTASAPTTPTRYPGQPGGTQQPPMYNGSPYHNMYSTSSANGTPNHQGYPNGQPQETPNRPNGGNGGGSSHIAAMEDSLRQILKLDSPFGGAPSPGIYRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.76
3 0.77
4 0.79
5 0.8
6 0.8
7 0.79
8 0.81
9 0.82
10 0.88
11 0.88
12 0.85
13 0.83
14 0.8
15 0.78
16 0.76
17 0.76
18 0.7
19 0.7
20 0.66
21 0.59
22 0.52
23 0.44
24 0.35
25 0.26
26 0.24
27 0.21
28 0.23
29 0.22
30 0.22
31 0.24
32 0.26
33 0.33
34 0.36
35 0.44
36 0.43
37 0.5
38 0.58
39 0.67
40 0.73
41 0.75
42 0.77
43 0.75
44 0.77
45 0.75
46 0.75
47 0.74
48 0.71
49 0.7
50 0.7
51 0.71
52 0.69
53 0.7
54 0.68
55 0.68
56 0.67
57 0.63
58 0.61
59 0.56
60 0.56
61 0.54
62 0.48
63 0.39
64 0.39
65 0.39
66 0.35
67 0.37
68 0.35
69 0.31
70 0.31
71 0.31
72 0.28
73 0.29
74 0.32
75 0.32
76 0.39
77 0.47
78 0.55
79 0.65
80 0.69
81 0.72
82 0.77
83 0.82
84 0.8
85 0.77
86 0.71
87 0.64
88 0.59
89 0.53
90 0.49
91 0.47
92 0.47
93 0.44
94 0.5
95 0.58
96 0.63
97 0.68
98 0.7
99 0.7
100 0.71
101 0.73
102 0.69
103 0.66
104 0.62
105 0.56
106 0.47
107 0.4
108 0.31
109 0.25
110 0.21
111 0.13
112 0.09
113 0.08
114 0.07
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.05
121 0.05
122 0.06
123 0.07
124 0.07
125 0.07
126 0.09
127 0.1
128 0.1
129 0.1
130 0.12
131 0.13
132 0.14
133 0.19
134 0.18
135 0.19
136 0.18
137 0.21
138 0.2
139 0.2
140 0.22
141 0.18
142 0.21
143 0.25
144 0.28
145 0.25
146 0.26
147 0.26
148 0.23
149 0.24
150 0.21
151 0.19
152 0.21
153 0.25
154 0.26
155 0.27
156 0.27
157 0.28
158 0.27
159 0.25
160 0.2
161 0.17
162 0.18
163 0.18
164 0.19
165 0.2
166 0.2
167 0.19
168 0.18
169 0.17
170 0.14
171 0.12
172 0.1
173 0.08
174 0.08
175 0.08
176 0.07
177 0.07
178 0.08
179 0.1
180 0.12
181 0.11
182 0.12
183 0.13
184 0.15
185 0.16
186 0.17
187 0.14
188 0.13
189 0.15
190 0.16
191 0.16
192 0.15
193 0.14
194 0.14
195 0.13
196 0.13
197 0.13
198 0.1
199 0.1
200 0.11
201 0.12
202 0.13
203 0.12
204 0.12
205 0.11
206 0.11
207 0.1
208 0.09
209 0.09
210 0.08
211 0.09
212 0.14
213 0.23
214 0.28
215 0.37
216 0.45
217 0.51
218 0.53
219 0.54
220 0.5
221 0.49
222 0.48
223 0.44
224 0.38
225 0.31
226 0.28
227 0.26
228 0.24
229 0.17
230 0.12
231 0.08
232 0.06
233 0.06
234 0.07
235 0.09
236 0.09
237 0.12
238 0.12
239 0.12
240 0.12
241 0.16
242 0.18
243 0.17
244 0.16
245 0.16
246 0.16
247 0.16
248 0.16
249 0.11
250 0.09
251 0.09
252 0.09
253 0.08
254 0.1
255 0.11
256 0.16
257 0.23
258 0.29
259 0.31
260 0.35
261 0.37
262 0.41
263 0.46
264 0.5
265 0.46
266 0.41
267 0.42
268 0.42
269 0.49
270 0.53
271 0.56
272 0.5
273 0.52
274 0.52
275 0.5
276 0.46
277 0.37
278 0.27
279 0.17
280 0.15
281 0.09
282 0.08
283 0.07
284 0.06
285 0.06
286 0.06
287 0.06
288 0.05
289 0.05
290 0.05
291 0.05
292 0.06
293 0.06
294 0.06
295 0.07
296 0.1
297 0.13
298 0.13
299 0.17
300 0.16
301 0.18
302 0.19
303 0.22
304 0.24
305 0.26
306 0.26
307 0.29
308 0.3
309 0.3
310 0.34
311 0.31
312 0.28
313 0.23
314 0.24
315 0.18
316 0.17
317 0.14
318 0.12
319 0.11
320 0.1
321 0.11
322 0.11
323 0.12
324 0.11
325 0.12
326 0.11
327 0.11
328 0.11
329 0.1
330 0.08
331 0.09
332 0.08
333 0.06
334 0.06
335 0.05
336 0.07
337 0.07
338 0.08
339 0.09
340 0.14
341 0.15
342 0.15
343 0.15
344 0.14
345 0.15
346 0.16
347 0.16
348 0.12
349 0.12
350 0.13
351 0.14
352 0.14
353 0.14
354 0.15
355 0.14
356 0.17
357 0.19
358 0.19
359 0.2
360 0.22
361 0.23
362 0.21
363 0.24
364 0.23
365 0.23
366 0.23
367 0.22
368 0.24
369 0.25
370 0.27
371 0.24
372 0.23
373 0.24
374 0.24
375 0.23
376 0.21
377 0.25
378 0.25
379 0.24
380 0.25
381 0.27
382 0.3
383 0.3
384 0.31
385 0.28
386 0.27
387 0.31
388 0.34
389 0.35
390 0.35
391 0.39
392 0.43
393 0.42
394 0.42
395 0.39
396 0.36
397 0.34
398 0.35
399 0.31
400 0.27
401 0.26
402 0.29
403 0.34
404 0.33
405 0.34
406 0.31
407 0.31
408 0.3
409 0.33
410 0.29
411 0.25
412 0.24
413 0.22
414 0.24
415 0.24
416 0.25
417 0.27
418 0.28
419 0.27
420 0.27
421 0.28
422 0.29
423 0.37
424 0.41
425 0.38
426 0.36
427 0.35
428 0.4
429 0.49
430 0.52
431 0.46
432 0.44
433 0.45
434 0.46
435 0.47
436 0.44
437 0.37
438 0.32
439 0.28
440 0.26
441 0.21
442 0.21
443 0.2
444 0.17
445 0.13
446 0.11
447 0.11
448 0.09
449 0.09
450 0.1
451 0.1
452 0.12
453 0.11
454 0.11
455 0.13
456 0.13
457 0.18
458 0.2
459 0.22
460 0.21
461 0.24
462 0.24
463 0.24
464 0.23
465 0.17
466 0.15
467 0.16
468 0.18