Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5I5L1

Protein Details
Accession V5I5L1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-37RDCKVPFCVKTRRHRPKGGPDAARDBasic
NLS Segment(s)
PositionSequence
26-29HRPK
Subcellular Location(s) cyto 12, pero 6, nucl 5, mito 4
Family & Domain DBs
Amino Acid Sequences MGSIVWEYGYPERDCKVPFCVKTRRHRPKGGPDAARDIAKAGTRPLHKFVFSPEVLSISWKILVLTESDSEMWIAAPLSLTTQISVAWRMDAFHLLGFVDDEHHGQAKSLKQKATCVDTAIPTPEDEKRDTLVVIWDFER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.31
4 0.35
5 0.38
6 0.44
7 0.52
8 0.57
9 0.67
10 0.76
11 0.79
12 0.79
13 0.84
14 0.85
15 0.86
16 0.88
17 0.86
18 0.81
19 0.73
20 0.71
21 0.64
22 0.56
23 0.44
24 0.35
25 0.27
26 0.23
27 0.2
28 0.15
29 0.18
30 0.22
31 0.25
32 0.28
33 0.28
34 0.28
35 0.27
36 0.29
37 0.3
38 0.26
39 0.25
40 0.2
41 0.2
42 0.19
43 0.2
44 0.16
45 0.1
46 0.11
47 0.09
48 0.08
49 0.07
50 0.07
51 0.07
52 0.08
53 0.07
54 0.07
55 0.07
56 0.08
57 0.07
58 0.07
59 0.06
60 0.04
61 0.04
62 0.03
63 0.03
64 0.03
65 0.04
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.09
78 0.09
79 0.09
80 0.07
81 0.08
82 0.07
83 0.07
84 0.07
85 0.06
86 0.06
87 0.07
88 0.07
89 0.08
90 0.1
91 0.1
92 0.1
93 0.14
94 0.19
95 0.27
96 0.31
97 0.34
98 0.34
99 0.4
100 0.44
101 0.46
102 0.41
103 0.36
104 0.34
105 0.32
106 0.33
107 0.31
108 0.27
109 0.21
110 0.23
111 0.24
112 0.24
113 0.25
114 0.25
115 0.24
116 0.25
117 0.24
118 0.23
119 0.25
120 0.23