Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2AMD7

Protein Details
Accession B2AMD7   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
101-125TESARAQQKRHVHRRRRGKAPGPQGBasic
NLS Segment(s)
PositionSequence
108-130QKRHVHRRRRGKAPGPQGGRAKR
Subcellular Location(s) plas 14, mito 5, E.R. 2, vacu 2, nucl 1, extr 1, pero 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pan:PODANSg2246  -  
Amino Acid Sequences MICLDFIHIESRPLVSLFLSILLLPLKIILTLTSSILFLTSPLLTPLILLLLVLLLVPYALWLVLFLVENITSLSRHLARLLTLPFELLWEPFGWLINMITESARAQQKRHVHRRRRGKAPGPQGGRAKRVSVWEGRNEDDEADDDDGGNDEYVDYYQREYTYGEWGSQVEDPLRGPGARGAVHDGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.11
4 0.1
5 0.1
6 0.09
7 0.08
8 0.09
9 0.09
10 0.08
11 0.07
12 0.07
13 0.06
14 0.06
15 0.06
16 0.05
17 0.07
18 0.08
19 0.1
20 0.1
21 0.09
22 0.09
23 0.09
24 0.09
25 0.06
26 0.08
27 0.07
28 0.07
29 0.07
30 0.08
31 0.07
32 0.08
33 0.07
34 0.06
35 0.05
36 0.05
37 0.03
38 0.03
39 0.03
40 0.03
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.03
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.06
59 0.05
60 0.05
61 0.08
62 0.08
63 0.09
64 0.1
65 0.1
66 0.1
67 0.13
68 0.13
69 0.12
70 0.11
71 0.11
72 0.1
73 0.1
74 0.1
75 0.07
76 0.07
77 0.05
78 0.06
79 0.06
80 0.06
81 0.05
82 0.05
83 0.05
84 0.04
85 0.05
86 0.05
87 0.04
88 0.05
89 0.05
90 0.09
91 0.14
92 0.14
93 0.15
94 0.21
95 0.3
96 0.4
97 0.51
98 0.57
99 0.63
100 0.71
101 0.82
102 0.84
103 0.85
104 0.84
105 0.82
106 0.8
107 0.8
108 0.8
109 0.73
110 0.7
111 0.69
112 0.63
113 0.59
114 0.51
115 0.43
116 0.37
117 0.36
118 0.34
119 0.33
120 0.33
121 0.36
122 0.37
123 0.37
124 0.37
125 0.34
126 0.3
127 0.24
128 0.21
129 0.16
130 0.15
131 0.13
132 0.1
133 0.1
134 0.11
135 0.1
136 0.09
137 0.06
138 0.05
139 0.06
140 0.06
141 0.08
142 0.08
143 0.09
144 0.11
145 0.11
146 0.13
147 0.14
148 0.15
149 0.2
150 0.2
151 0.19
152 0.18
153 0.18
154 0.19
155 0.19
156 0.2
157 0.14
158 0.15
159 0.15
160 0.16
161 0.18
162 0.16
163 0.16
164 0.17
165 0.2
166 0.2
167 0.21