Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5G5M0

Protein Details
Accession V5G5M0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-40LLWKIPWRLSRPQKARQRKRLRAVDRVVDHydrophilic
NLS Segment(s)
PositionSequence
22-32RPQKARQRKRL
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSPLLGGLLWKIPWRLSRPQKARQRKRLRAVDRVVDTVSAALQRNGGLTTKAVERWYAEMPREEEMVPKDKYTIFDKKEKKYRKGLHSAYSPDLGWYSVSITLRIADWISPVQNFPSGLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.18
4 0.22
5 0.26
6 0.35
7 0.44
8 0.54
9 0.6
10 0.68
11 0.76
12 0.82
13 0.88
14 0.88
15 0.9
16 0.89
17 0.91
18 0.92
19 0.88
20 0.86
21 0.81
22 0.77
23 0.69
24 0.61
25 0.5
26 0.4
27 0.33
28 0.23
29 0.18
30 0.12
31 0.1
32 0.08
33 0.08
34 0.08
35 0.09
36 0.09
37 0.09
38 0.07
39 0.07
40 0.08
41 0.09
42 0.1
43 0.1
44 0.1
45 0.1
46 0.13
47 0.15
48 0.16
49 0.15
50 0.16
51 0.17
52 0.18
53 0.18
54 0.16
55 0.15
56 0.16
57 0.2
58 0.18
59 0.17
60 0.17
61 0.17
62 0.2
63 0.24
64 0.3
65 0.28
66 0.37
67 0.44
68 0.51
69 0.6
70 0.67
71 0.68
72 0.7
73 0.75
74 0.75
75 0.78
76 0.75
77 0.72
78 0.69
79 0.67
80 0.6
81 0.52
82 0.43
83 0.33
84 0.29
85 0.22
86 0.15
87 0.11
88 0.1
89 0.12
90 0.12
91 0.12
92 0.12
93 0.12
94 0.12
95 0.13
96 0.12
97 0.09
98 0.11
99 0.13
100 0.15
101 0.15
102 0.16
103 0.17
104 0.19