Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5G0X1

Protein Details
Accession V5G0X1   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
116-138GEGAAKPKTPRRRRAVKECIQDAHydrophilic
NLS Segment(s)
PositionSequence
86-98KTPRKPRARKGAK
121-129KPKTPRRRR
Subcellular Location(s) cyto_nucl 15, cyto 14, nucl 12
Family & Domain DBs
Amino Acid Sequences MATEGSIPRDDFGFALECLKSIDDNHNVDLTKVANALNYTNVQSVGNRYRVFRKKYGINLHCVTGSGVITTQDAGGDDIGGPSPVKTPRKPRARKGAKVSSDPIPATGDDTSNEPGEGAAKPKTPRRRRAVKECIQDADVDNLQAAIDEAVENVTKRNNIKAIKEESGDLADEDTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.14
4 0.13
5 0.14
6 0.14
7 0.13
8 0.13
9 0.2
10 0.23
11 0.26
12 0.27
13 0.29
14 0.28
15 0.28
16 0.27
17 0.21
18 0.15
19 0.14
20 0.12
21 0.11
22 0.12
23 0.12
24 0.13
25 0.14
26 0.14
27 0.14
28 0.15
29 0.14
30 0.14
31 0.19
32 0.22
33 0.26
34 0.26
35 0.27
36 0.36
37 0.44
38 0.5
39 0.49
40 0.5
41 0.5
42 0.58
43 0.67
44 0.6
45 0.59
46 0.54
47 0.5
48 0.44
49 0.37
50 0.29
51 0.19
52 0.16
53 0.09
54 0.08
55 0.07
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.07
71 0.12
72 0.16
73 0.2
74 0.29
75 0.39
76 0.5
77 0.56
78 0.62
79 0.68
80 0.74
81 0.77
82 0.77
83 0.77
84 0.7
85 0.67
86 0.62
87 0.55
88 0.48
89 0.41
90 0.33
91 0.24
92 0.2
93 0.18
94 0.15
95 0.12
96 0.09
97 0.12
98 0.12
99 0.11
100 0.11
101 0.09
102 0.08
103 0.09
104 0.1
105 0.1
106 0.1
107 0.15
108 0.18
109 0.26
110 0.37
111 0.45
112 0.54
113 0.61
114 0.7
115 0.75
116 0.83
117 0.86
118 0.84
119 0.84
120 0.78
121 0.71
122 0.61
123 0.53
124 0.44
125 0.38
126 0.29
127 0.2
128 0.16
129 0.13
130 0.12
131 0.11
132 0.09
133 0.04
134 0.04
135 0.04
136 0.04
137 0.05
138 0.07
139 0.07
140 0.08
141 0.11
142 0.15
143 0.17
144 0.22
145 0.29
146 0.33
147 0.39
148 0.45
149 0.5
150 0.5
151 0.5
152 0.45
153 0.4
154 0.37
155 0.32
156 0.24