Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5FQI9

Protein Details
Accession V5FQI9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
37-58MPRSGKVQRRRRESPRGRPHPABasic
NLS Segment(s)
PositionSequence
41-55GKVQRRRRESPRGRP
Subcellular Location(s) cysk 17, cyto 5, nucl 4
Family & Domain DBs
Amino Acid Sequences MEEEVGAIVFWEYAASEVSDPSDRVVISLGWEAFPLMPRSGKVQRRRRESPRGRPHPAVSLAAWRGEQRAAESLGDFCSARGWLVAGHVQEILPVVFQLDGSRDANQPRGAGDNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.06
4 0.07
5 0.09
6 0.11
7 0.11
8 0.11
9 0.13
10 0.11
11 0.11
12 0.12
13 0.1
14 0.1
15 0.13
16 0.12
17 0.11
18 0.11
19 0.11
20 0.1
21 0.12
22 0.12
23 0.1
24 0.11
25 0.11
26 0.17
27 0.26
28 0.33
29 0.41
30 0.49
31 0.56
32 0.64
33 0.72
34 0.75
35 0.78
36 0.8
37 0.81
38 0.82
39 0.83
40 0.8
41 0.75
42 0.68
43 0.62
44 0.53
45 0.44
46 0.33
47 0.28
48 0.23
49 0.2
50 0.19
51 0.14
52 0.13
53 0.12
54 0.12
55 0.09
56 0.1
57 0.11
58 0.11
59 0.11
60 0.11
61 0.11
62 0.12
63 0.1
64 0.08
65 0.08
66 0.08
67 0.07
68 0.07
69 0.06
70 0.05
71 0.08
72 0.1
73 0.1
74 0.1
75 0.11
76 0.1
77 0.1
78 0.11
79 0.09
80 0.06
81 0.06
82 0.05
83 0.05
84 0.05
85 0.06
86 0.07
87 0.11
88 0.12
89 0.15
90 0.18
91 0.21
92 0.26
93 0.27
94 0.26
95 0.24