Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2B0P8

Protein Details
Accession B2B0P8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
165-185IDRERVKRKTDAEKREKRLIABasic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR040049  MRPS25  
IPR007741  Ribosome/NADH_DH  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
KEGG pan:PODANSg6526  -  
Pfam View protein in Pfam  
PF05047  L51_S25_CI-B8  
Amino Acid Sequences MVGVIRRLHKLKALLDIRCGPGAAIFPSDVTRIHLEFAYGLAGHLGPRKFWNTNLPRLKFWNPAIPMIVNRTTDVTGPAVLSVYFREPGSILQELQTPSSSFHGFAKAPQPAEGERVLTIDMKNLPSEKILDELISKSGAVPVRPTPQDEADLAELRDLERTGEIDRERVKRKTDAEKREKRLIAQAQSEAAAIRAAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.49
4 0.46
5 0.41
6 0.38
7 0.28
8 0.22
9 0.22
10 0.17
11 0.14
12 0.12
13 0.12
14 0.13
15 0.14
16 0.13
17 0.14
18 0.16
19 0.15
20 0.16
21 0.15
22 0.15
23 0.14
24 0.14
25 0.11
26 0.08
27 0.08
28 0.07
29 0.07
30 0.07
31 0.12
32 0.12
33 0.12
34 0.15
35 0.2
36 0.21
37 0.23
38 0.33
39 0.34
40 0.44
41 0.53
42 0.53
43 0.5
44 0.55
45 0.57
46 0.53
47 0.49
48 0.47
49 0.39
50 0.38
51 0.37
52 0.32
53 0.29
54 0.26
55 0.27
56 0.19
57 0.18
58 0.18
59 0.17
60 0.16
61 0.16
62 0.12
63 0.1
64 0.09
65 0.09
66 0.07
67 0.07
68 0.07
69 0.06
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.08
76 0.11
77 0.11
78 0.1
79 0.1
80 0.13
81 0.13
82 0.13
83 0.13
84 0.1
85 0.1
86 0.12
87 0.12
88 0.1
89 0.1
90 0.13
91 0.12
92 0.13
93 0.18
94 0.18
95 0.18
96 0.18
97 0.19
98 0.17
99 0.19
100 0.18
101 0.14
102 0.11
103 0.11
104 0.11
105 0.1
106 0.1
107 0.1
108 0.11
109 0.11
110 0.12
111 0.12
112 0.12
113 0.12
114 0.13
115 0.11
116 0.11
117 0.1
118 0.1
119 0.11
120 0.11
121 0.11
122 0.1
123 0.09
124 0.08
125 0.11
126 0.12
127 0.12
128 0.14
129 0.17
130 0.23
131 0.24
132 0.26
133 0.26
134 0.26
135 0.28
136 0.26
137 0.25
138 0.22
139 0.23
140 0.2
141 0.17
142 0.16
143 0.14
144 0.15
145 0.12
146 0.09
147 0.08
148 0.1
149 0.1
150 0.16
151 0.17
152 0.21
153 0.27
154 0.34
155 0.4
156 0.44
157 0.47
158 0.49
159 0.55
160 0.61
161 0.65
162 0.68
163 0.73
164 0.78
165 0.81
166 0.84
167 0.79
168 0.71
169 0.7
170 0.68
171 0.64
172 0.59
173 0.54
174 0.45
175 0.43
176 0.41
177 0.31
178 0.23