Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5F8K2

Protein Details
Accession V5F8K2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
453-477FNSGHERRKAMWRRKNEQAAKKIAAHydrophilic
NLS Segment(s)
PositionSequence
459-476RRKAMWRRKNEQAAKKIA
Subcellular Location(s) cyto 12, cyto_mito 9.333, cyto_nucl 6.833, pero 6, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR000960  Flavin_mOase  
IPR020946  Flavin_mOase-like  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
GO:0004499  F:N,N-dimethylaniline monooxygenase activity  
GO:0050661  F:NADP binding  
Pfam View protein in Pfam  
PF00743  FMO-like  
Amino Acid Sequences MVKQVKSVAVIGAGPGGAIAVDALAQEKAFDVIRVFERREKAGGCWVYDEDEPPALSDFDQLSNRTAGGAIEIPEKLPGYAPRSPSNRFTDTGVYPALETNVDAAAMSYSQEHIPEIRTKNSIDLHGPDTPFRHHTVIRQWVEDLLNRNGYQDLVEYNTTVEKAVKDPKSDKWILTLRKAEKAGKEDYWWTEEFDALVVASGHYSVPYIPHIKGLKEFAEAHPGSIEHTKAYRRPEKYRGKRVITVGASVSAADTAVSIVDIVKPPVYAVVRGKYNVYFGDEAFKHPNIERKPPISHVSPDDRTVYFEDGTSVSNVDYILFGTGFTWNLPFLPDIPTRNNRIPDLYLQVFHQRDPTLTFVGAVGAGLTFKVFEWQAVLAARVLAGKAQLPPLSEQQKWERDRIAEKGDGPAFAVIYPRFEEYFETLRKLAGNPKPGEPGRRLPEFDPRWVDIFNSGHERRKAMWRRKNEQAAKKIAASKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.06
4 0.04
5 0.04
6 0.03
7 0.02
8 0.03
9 0.03
10 0.05
11 0.05
12 0.05
13 0.05
14 0.06
15 0.08
16 0.08
17 0.09
18 0.09
19 0.13
20 0.2
21 0.25
22 0.28
23 0.33
24 0.36
25 0.38
26 0.42
27 0.4
28 0.36
29 0.41
30 0.4
31 0.35
32 0.34
33 0.32
34 0.31
35 0.3
36 0.29
37 0.21
38 0.2
39 0.19
40 0.16
41 0.17
42 0.14
43 0.14
44 0.15
45 0.15
46 0.17
47 0.2
48 0.2
49 0.21
50 0.21
51 0.21
52 0.18
53 0.17
54 0.12
55 0.12
56 0.13
57 0.12
58 0.13
59 0.14
60 0.14
61 0.15
62 0.15
63 0.13
64 0.14
65 0.17
66 0.21
67 0.25
68 0.29
69 0.36
70 0.41
71 0.44
72 0.49
73 0.51
74 0.49
75 0.45
76 0.44
77 0.42
78 0.38
79 0.37
80 0.31
81 0.24
82 0.2
83 0.19
84 0.17
85 0.11
86 0.1
87 0.09
88 0.08
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.06
95 0.05
96 0.07
97 0.07
98 0.08
99 0.08
100 0.09
101 0.12
102 0.2
103 0.22
104 0.25
105 0.27
106 0.27
107 0.31
108 0.33
109 0.32
110 0.27
111 0.27
112 0.28
113 0.29
114 0.3
115 0.26
116 0.26
117 0.27
118 0.26
119 0.26
120 0.26
121 0.23
122 0.27
123 0.34
124 0.43
125 0.41
126 0.4
127 0.37
128 0.36
129 0.36
130 0.34
131 0.31
132 0.24
133 0.25
134 0.24
135 0.24
136 0.22
137 0.2
138 0.17
139 0.13
140 0.11
141 0.1
142 0.1
143 0.09
144 0.1
145 0.1
146 0.1
147 0.1
148 0.1
149 0.08
150 0.12
151 0.2
152 0.22
153 0.26
154 0.29
155 0.34
156 0.4
157 0.42
158 0.38
159 0.37
160 0.42
161 0.41
162 0.45
163 0.48
164 0.42
165 0.46
166 0.48
167 0.45
168 0.42
169 0.42
170 0.39
171 0.33
172 0.32
173 0.29
174 0.28
175 0.28
176 0.25
177 0.21
178 0.18
179 0.17
180 0.15
181 0.12
182 0.1
183 0.06
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.05
194 0.07
195 0.1
196 0.1
197 0.16
198 0.17
199 0.18
200 0.2
201 0.21
202 0.2
203 0.2
204 0.22
205 0.16
206 0.24
207 0.23
208 0.21
209 0.19
210 0.18
211 0.17
212 0.17
213 0.16
214 0.08
215 0.11
216 0.13
217 0.16
218 0.24
219 0.3
220 0.34
221 0.4
222 0.49
223 0.58
224 0.66
225 0.73
226 0.74
227 0.71
228 0.7
229 0.66
230 0.63
231 0.52
232 0.43
233 0.33
234 0.25
235 0.2
236 0.16
237 0.13
238 0.06
239 0.05
240 0.04
241 0.03
242 0.03
243 0.03
244 0.02
245 0.03
246 0.03
247 0.04
248 0.05
249 0.05
250 0.05
251 0.05
252 0.05
253 0.09
254 0.09
255 0.1
256 0.13
257 0.16
258 0.17
259 0.18
260 0.19
261 0.17
262 0.18
263 0.16
264 0.16
265 0.13
266 0.12
267 0.18
268 0.17
269 0.2
270 0.22
271 0.22
272 0.2
273 0.21
274 0.28
275 0.26
276 0.33
277 0.35
278 0.36
279 0.38
280 0.41
281 0.44
282 0.39
283 0.38
284 0.36
285 0.39
286 0.36
287 0.35
288 0.34
289 0.3
290 0.29
291 0.28
292 0.25
293 0.17
294 0.16
295 0.15
296 0.13
297 0.13
298 0.12
299 0.1
300 0.08
301 0.08
302 0.08
303 0.07
304 0.06
305 0.05
306 0.05
307 0.05
308 0.05
309 0.05
310 0.06
311 0.06
312 0.06
313 0.06
314 0.06
315 0.06
316 0.07
317 0.07
318 0.07
319 0.12
320 0.15
321 0.18
322 0.25
323 0.3
324 0.34
325 0.39
326 0.42
327 0.38
328 0.38
329 0.37
330 0.33
331 0.35
332 0.31
333 0.26
334 0.25
335 0.31
336 0.29
337 0.27
338 0.28
339 0.22
340 0.21
341 0.23
342 0.25
343 0.19
344 0.18
345 0.18
346 0.14
347 0.14
348 0.12
349 0.09
350 0.06
351 0.04
352 0.04
353 0.04
354 0.04
355 0.03
356 0.03
357 0.06
358 0.06
359 0.06
360 0.08
361 0.09
362 0.11
363 0.11
364 0.12
365 0.1
366 0.1
367 0.1
368 0.09
369 0.08
370 0.07
371 0.07
372 0.08
373 0.1
374 0.13
375 0.14
376 0.15
377 0.18
378 0.26
379 0.31
380 0.3
381 0.34
382 0.39
383 0.47
384 0.49
385 0.5
386 0.47
387 0.46
388 0.5
389 0.5
390 0.48
391 0.42
392 0.4
393 0.43
394 0.39
395 0.35
396 0.31
397 0.26
398 0.2
399 0.16
400 0.2
401 0.13
402 0.14
403 0.16
404 0.17
405 0.17
406 0.17
407 0.2
408 0.21
409 0.28
410 0.28
411 0.3
412 0.28
413 0.29
414 0.3
415 0.3
416 0.34
417 0.33
418 0.4
419 0.39
420 0.43
421 0.5
422 0.52
423 0.56
424 0.52
425 0.55
426 0.52
427 0.55
428 0.56
429 0.49
430 0.57
431 0.55
432 0.57
433 0.53
434 0.49
435 0.46
436 0.42
437 0.41
438 0.36
439 0.34
440 0.3
441 0.34
442 0.35
443 0.4
444 0.43
445 0.45
446 0.42
447 0.51
448 0.58
449 0.59
450 0.65
451 0.68
452 0.73
453 0.81
454 0.88
455 0.87
456 0.87
457 0.85
458 0.84
459 0.78
460 0.76