Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5FI69

Protein Details
Accession V5FI69   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-40RVNVVYKGWKEKRRKGPQVDLEKCEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.333, nucl 12, cyto 11.5, mito_nucl 8.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR024645  Mitochondr_Som1  
Gene Ontology GO:0042720  C:mitochondrial inner membrane peptidase complex  
Pfam View protein in Pfam  
PF11093  Mitochondr_Som1  
Amino Acid Sequences MAPLVPVFPTEALPERVNVVYKGWKEKRRKGPQVDLEKCELREMLQYSCNPPQEGVPSPGVVVCKPVLRLFRRCAGGLTIETTSWETLQNEQRKDGGASGGKTTGVKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.22
4 0.23
5 0.21
6 0.2
7 0.23
8 0.25
9 0.35
10 0.41
11 0.48
12 0.55
13 0.65
14 0.73
15 0.77
16 0.84
17 0.82
18 0.84
19 0.85
20 0.87
21 0.83
22 0.75
23 0.68
24 0.61
25 0.52
26 0.43
27 0.33
28 0.22
29 0.21
30 0.19
31 0.16
32 0.18
33 0.18
34 0.21
35 0.26
36 0.26
37 0.22
38 0.2
39 0.19
40 0.19
41 0.2
42 0.19
43 0.16
44 0.14
45 0.14
46 0.15
47 0.15
48 0.11
49 0.11
50 0.09
51 0.09
52 0.1
53 0.13
54 0.19
55 0.23
56 0.29
57 0.31
58 0.36
59 0.37
60 0.36
61 0.35
62 0.3
63 0.28
64 0.23
65 0.22
66 0.17
67 0.14
68 0.15
69 0.15
70 0.13
71 0.11
72 0.13
73 0.11
74 0.17
75 0.26
76 0.32
77 0.33
78 0.34
79 0.35
80 0.35
81 0.35
82 0.31
83 0.28
84 0.26
85 0.26
86 0.27
87 0.27
88 0.25
89 0.26