Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5F973

Protein Details
Accession V5F973   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
48-73GAERYQRAKRNREKARENRKRIEQIWHydrophilic
NLS Segment(s)
PositionSequence
54-68RAKRNREKARENRKR
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 5, cyto 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHSHLHTPENANCEEIMTMLDECHARGFLWKALGQCNDIKTEVNKCLGAERYQRAKRNREKARENRKRIEQIWAEERVREGVVAPADTTAAGSAEAKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.16
3 0.12
4 0.09
5 0.09
6 0.07
7 0.09
8 0.08
9 0.09
10 0.09
11 0.09
12 0.07
13 0.1
14 0.13
15 0.13
16 0.16
17 0.18
18 0.18
19 0.22
20 0.24
21 0.23
22 0.23
23 0.22
24 0.21
25 0.2
26 0.19
27 0.17
28 0.19
29 0.19
30 0.19
31 0.18
32 0.16
33 0.18
34 0.19
35 0.2
36 0.21
37 0.23
38 0.31
39 0.36
40 0.44
41 0.48
42 0.56
43 0.61
44 0.68
45 0.72
46 0.72
47 0.77
48 0.81
49 0.86
50 0.87
51 0.86
52 0.83
53 0.82
54 0.81
55 0.72
56 0.7
57 0.63
58 0.59
59 0.56
60 0.55
61 0.47
62 0.4
63 0.39
64 0.32
65 0.27
66 0.21
67 0.16
68 0.13
69 0.14
70 0.14
71 0.13
72 0.12
73 0.12
74 0.11
75 0.11
76 0.07
77 0.06
78 0.06