Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5G0X9

Protein Details
Accession V5G0X9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-42VQVPVTPKKRCRNRESETPNTPHydrophilic
NLS Segment(s)
PositionSequence
46-60KKGKATPGKGTPKKG
Subcellular Location(s) nucl 15, cyto 7.5, cyto_mito 5.5, mito 2.5
Family & Domain DBs
Amino Acid Sequences MAYVKNEFDMDTSVAPSDLMVQVPVTPKKRCRNRESETPNTPTPVKKGKATPGKGTPKKGTMRPIPSSFEEAGPEDRLLIQMKDKENKSWAEIKEAWASLTGLQVGGSTLAVRYTRLKANFFTWTAQDEANLLEAKKEVEEKIEQEKWHRIADAIETKNGSKFPAAAVQKKFKELSKRSNYPSAGIPKEESNDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.11
5 0.1
6 0.1
7 0.09
8 0.09
9 0.11
10 0.18
11 0.24
12 0.27
13 0.33
14 0.41
15 0.52
16 0.62
17 0.69
18 0.73
19 0.76
20 0.78
21 0.83
22 0.83
23 0.82
24 0.79
25 0.75
26 0.67
27 0.61
28 0.56
29 0.47
30 0.44
31 0.44
32 0.39
33 0.38
34 0.42
35 0.48
36 0.56
37 0.58
38 0.59
39 0.6
40 0.68
41 0.68
42 0.7
43 0.64
44 0.62
45 0.63
46 0.6
47 0.59
48 0.56
49 0.58
50 0.58
51 0.56
52 0.53
53 0.49
54 0.49
55 0.42
56 0.34
57 0.28
58 0.23
59 0.22
60 0.19
61 0.16
62 0.12
63 0.11
64 0.12
65 0.11
66 0.1
67 0.11
68 0.15
69 0.18
70 0.24
71 0.25
72 0.26
73 0.28
74 0.28
75 0.29
76 0.31
77 0.28
78 0.28
79 0.28
80 0.29
81 0.28
82 0.27
83 0.24
84 0.17
85 0.17
86 0.11
87 0.11
88 0.08
89 0.05
90 0.05
91 0.05
92 0.04
93 0.04
94 0.04
95 0.03
96 0.03
97 0.04
98 0.05
99 0.06
100 0.08
101 0.11
102 0.16
103 0.19
104 0.21
105 0.21
106 0.24
107 0.27
108 0.26
109 0.25
110 0.21
111 0.21
112 0.2
113 0.18
114 0.15
115 0.12
116 0.11
117 0.11
118 0.11
119 0.09
120 0.08
121 0.08
122 0.09
123 0.09
124 0.11
125 0.09
126 0.12
127 0.14
128 0.16
129 0.24
130 0.28
131 0.28
132 0.31
133 0.38
134 0.38
135 0.37
136 0.35
137 0.28
138 0.25
139 0.31
140 0.36
141 0.3
142 0.3
143 0.29
144 0.3
145 0.31
146 0.3
147 0.24
148 0.16
149 0.14
150 0.14
151 0.22
152 0.27
153 0.32
154 0.39
155 0.47
156 0.48
157 0.52
158 0.53
159 0.5
160 0.55
161 0.56
162 0.6
163 0.61
164 0.67
165 0.69
166 0.75
167 0.7
168 0.62
169 0.62
170 0.6
171 0.53
172 0.48
173 0.44
174 0.39