Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5FQ60

Protein Details
Accession V5FQ60    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
82-102LDLRAKKTRAIRRRLTKHEASHydrophilic
104-124VTEKERKRQIHFPQRKYAVKVHydrophilic
NLS Segment(s)
PositionSequence
85-99RAKKTRAIRRRLTKH
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSAKVKTGQLWGKSKDDLTKQLEELKTELNQIRVQKVSGGAASKLTRIHDLRKSIARILTVINANQRAQLRLFYKNKKYLPLDLRAKKTRAIRRRLTKHEASLVTEKERKRQIHFPQRKYAVKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.46
4 0.46
5 0.44
6 0.43
7 0.41
8 0.46
9 0.45
10 0.39
11 0.36
12 0.31
13 0.26
14 0.28
15 0.28
16 0.24
17 0.26
18 0.27
19 0.29
20 0.27
21 0.26
22 0.22
23 0.21
24 0.19
25 0.17
26 0.16
27 0.13
28 0.15
29 0.16
30 0.15
31 0.16
32 0.16
33 0.19
34 0.19
35 0.25
36 0.26
37 0.29
38 0.32
39 0.35
40 0.36
41 0.33
42 0.33
43 0.27
44 0.23
45 0.2
46 0.2
47 0.15
48 0.14
49 0.15
50 0.15
51 0.14
52 0.17
53 0.17
54 0.15
55 0.14
56 0.18
57 0.18
58 0.25
59 0.33
60 0.37
61 0.44
62 0.51
63 0.52
64 0.54
65 0.55
66 0.55
67 0.53
68 0.54
69 0.57
70 0.56
71 0.63
72 0.62
73 0.6
74 0.57
75 0.61
76 0.62
77 0.61
78 0.63
79 0.65
80 0.7
81 0.78
82 0.82
83 0.81
84 0.77
85 0.73
86 0.72
87 0.64
88 0.59
89 0.55
90 0.5
91 0.48
92 0.48
93 0.44
94 0.44
95 0.5
96 0.49
97 0.5
98 0.56
99 0.61
100 0.67
101 0.76
102 0.75
103 0.78
104 0.82