Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2AXP8

Protein Details
Accession B2AXP8   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MANNRVTYRRRNPYNTSSNRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pan:PODANSg5534  -  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MANNRVTYRRRNPYNTSSNRTRVVKTPGGELRVLHIKKRGTAPKCGDCGIKLPGIPALRPKEYAQISKPKKTVQRAYGGSRCGNCVRDRIVRAFLIEEQKIVKKVLKEQTAADKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.78
4 0.75
5 0.72
6 0.71
7 0.67
8 0.6
9 0.55
10 0.54
11 0.51
12 0.45
13 0.47
14 0.44
15 0.43
16 0.41
17 0.35
18 0.31
19 0.35
20 0.34
21 0.29
22 0.3
23 0.28
24 0.31
25 0.39
26 0.44
27 0.38
28 0.46
29 0.51
30 0.52
31 0.53
32 0.51
33 0.43
34 0.35
35 0.35
36 0.28
37 0.22
38 0.16
39 0.14
40 0.16
41 0.16
42 0.15
43 0.18
44 0.2
45 0.19
46 0.21
47 0.22
48 0.25
49 0.27
50 0.3
51 0.28
52 0.35
53 0.39
54 0.43
55 0.45
56 0.43
57 0.48
58 0.53
59 0.57
60 0.52
61 0.56
62 0.54
63 0.59
64 0.58
65 0.55
66 0.5
67 0.42
68 0.41
69 0.35
70 0.34
71 0.28
72 0.27
73 0.29
74 0.33
75 0.35
76 0.35
77 0.36
78 0.34
79 0.33
80 0.32
81 0.31
82 0.3
83 0.27
84 0.24
85 0.24
86 0.27
87 0.28
88 0.27
89 0.27
90 0.24
91 0.33
92 0.41
93 0.44
94 0.42
95 0.45
96 0.54