Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5FGF8

Protein Details
Accession V5FGF8    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-31VPTSADPRSKRPLKRRALTPVSEHydrophilic
118-151EEQRRKDAEKTEKNRKKREKRKAGKNKKGSASNGBasic
NLS Segment(s)
PositionSequence
114-146EKKREEQRRKDAEKTEKNRKKREKRKAGKNKKG
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSESIPESVPTSADPRSKRPLKRRALTPVSEQATQIESLFKDPTKDIQIPPPKREKTSAALPPPPEIVANVQGSSAGAGSGEFHVYKASRRREYERIQMMEQEVRKEKADEEFEKKREEQRRKDAEKTEKNRKKREKRKAGKNKKGSASNGDVEMKVDGPNGAAGGPTGGSKGVRQEDVQAAPDGTEARDHEEPGVIIHDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.43
4 0.52
5 0.6
6 0.67
7 0.72
8 0.76
9 0.81
10 0.83
11 0.83
12 0.83
13 0.77
14 0.73
15 0.72
16 0.65
17 0.57
18 0.48
19 0.39
20 0.33
21 0.29
22 0.23
23 0.16
24 0.13
25 0.14
26 0.17
27 0.16
28 0.16
29 0.16
30 0.21
31 0.24
32 0.27
33 0.27
34 0.34
35 0.44
36 0.48
37 0.53
38 0.59
39 0.56
40 0.56
41 0.58
42 0.52
43 0.47
44 0.51
45 0.52
46 0.48
47 0.5
48 0.48
49 0.45
50 0.41
51 0.36
52 0.27
53 0.2
54 0.16
55 0.15
56 0.15
57 0.14
58 0.13
59 0.12
60 0.12
61 0.11
62 0.09
63 0.04
64 0.03
65 0.03
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.07
72 0.07
73 0.12
74 0.19
75 0.26
76 0.31
77 0.35
78 0.41
79 0.48
80 0.52
81 0.57
82 0.56
83 0.51
84 0.46
85 0.44
86 0.39
87 0.35
88 0.31
89 0.26
90 0.21
91 0.19
92 0.19
93 0.19
94 0.18
95 0.19
96 0.24
97 0.24
98 0.29
99 0.34
100 0.35
101 0.38
102 0.38
103 0.42
104 0.46
105 0.51
106 0.53
107 0.57
108 0.66
109 0.69
110 0.74
111 0.74
112 0.75
113 0.76
114 0.75
115 0.76
116 0.74
117 0.78
118 0.82
119 0.84
120 0.85
121 0.86
122 0.89
123 0.89
124 0.91
125 0.94
126 0.95
127 0.95
128 0.95
129 0.94
130 0.91
131 0.87
132 0.83
133 0.75
134 0.7
135 0.64
136 0.55
137 0.48
138 0.41
139 0.34
140 0.28
141 0.25
142 0.19
143 0.14
144 0.12
145 0.09
146 0.07
147 0.08
148 0.07
149 0.06
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.06
157 0.07
158 0.08
159 0.14
160 0.17
161 0.19
162 0.2
163 0.24
164 0.29
165 0.3
166 0.32
167 0.27
168 0.24
169 0.22
170 0.22
171 0.18
172 0.13
173 0.14
174 0.13
175 0.18
176 0.19
177 0.2
178 0.2
179 0.21
180 0.21
181 0.19
182 0.21