Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5GD24

Protein Details
Accession V5GD24   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
50-76VNSGITKKKSKSKPKTRAQRLRQEKGLHydrophilic
NLS Segment(s)
PositionSequence
56-73KKKSKSKPKTRAQRLRQE
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MAKTPKVKGNSKPSTHSRAARRAASPSVDLDKSLISLPRPETPQIPSTHVNSGITKKKSKSKPKTRAQRLRQEKGLERAEIVMDQLEKKVNKSLERGRSINRRKVDWEDLNRKSNRFTAALEVENDGQEEQDNAMEDDNDVRIEKFTRQTVFSAATAGPVAEQPAGLDEDEEIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.7
4 0.68
5 0.67
6 0.69
7 0.67
8 0.62
9 0.58
10 0.55
11 0.5
12 0.43
13 0.37
14 0.36
15 0.31
16 0.28
17 0.24
18 0.2
19 0.18
20 0.18
21 0.16
22 0.12
23 0.16
24 0.18
25 0.22
26 0.25
27 0.26
28 0.27
29 0.28
30 0.33
31 0.31
32 0.34
33 0.31
34 0.31
35 0.33
36 0.32
37 0.3
38 0.27
39 0.31
40 0.34
41 0.36
42 0.38
43 0.39
44 0.47
45 0.55
46 0.64
47 0.68
48 0.72
49 0.78
50 0.83
51 0.9
52 0.92
53 0.93
54 0.9
55 0.9
56 0.88
57 0.84
58 0.79
59 0.73
60 0.66
61 0.63
62 0.57
63 0.46
64 0.37
65 0.31
66 0.26
67 0.2
68 0.16
69 0.09
70 0.06
71 0.06
72 0.07
73 0.1
74 0.1
75 0.1
76 0.15
77 0.17
78 0.18
79 0.24
80 0.31
81 0.36
82 0.41
83 0.42
84 0.43
85 0.51
86 0.57
87 0.59
88 0.53
89 0.48
90 0.46
91 0.5
92 0.53
93 0.5
94 0.52
95 0.54
96 0.57
97 0.63
98 0.61
99 0.56
100 0.5
101 0.45
102 0.39
103 0.31
104 0.27
105 0.25
106 0.26
107 0.27
108 0.25
109 0.24
110 0.21
111 0.19
112 0.18
113 0.12
114 0.09
115 0.08
116 0.07
117 0.06
118 0.07
119 0.07
120 0.07
121 0.08
122 0.08
123 0.08
124 0.09
125 0.09
126 0.09
127 0.08
128 0.09
129 0.1
130 0.12
131 0.16
132 0.19
133 0.24
134 0.26
135 0.28
136 0.29
137 0.31
138 0.32
139 0.28
140 0.26
141 0.2
142 0.19
143 0.17
144 0.15
145 0.12
146 0.09
147 0.11
148 0.08
149 0.08
150 0.07
151 0.09
152 0.1
153 0.1
154 0.09