Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5GAS7

Protein Details
Accession V5GAS7   
Localization Confidence High
Confidence Score 23.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-79ASVTRSPRPRRSVTRSRSRTRSRSPYSHydrophilic
123-143SYDRGYRDRRRRPYHDYDREEBasic
152-178TDDYDRPRDKRHRTRSRSPYRDVRKPKBasic
NLS Segment(s)
PositionSequence
57-77RSPRPRRSVTRSRSRTRSRSP
88-89KR
159-177RDKRHRTRSRSPYRDVRKP
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Gene Ontology GO:0004674  F:protein serine/threonine kinase activity  
GO:0016310  P:phosphorylation  
Amino Acid Sequences MASHRSRSSTPSEGEIIESGSETKATTSHTSLNGTSVDRPTRPSLSSAPRSPASVTRSPRPRRSVTRSRSRTRSRSPYSPYRDFRGEKRRRDDDFYDDRRVRHVPPPRRYESRYDDRYHDDRSYDRGYRDRRRRPYHDYDREEGYGGSLRYTDDYDRPRDKRHRTRSRSPYRDVRKPKQYSRDELEPRKNDSLARQTGGRRDSTEQSVSERGKTPVVAQESGKEAETRENQVQQQDSTHTRPRKVTIVDASATEETREEPEPQLSEPADEAAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.24
4 0.18
5 0.16
6 0.13
7 0.11
8 0.11
9 0.09
10 0.09
11 0.09
12 0.13
13 0.16
14 0.18
15 0.22
16 0.25
17 0.28
18 0.27
19 0.28
20 0.26
21 0.25
22 0.25
23 0.26
24 0.28
25 0.26
26 0.3
27 0.33
28 0.34
29 0.34
30 0.34
31 0.36
32 0.41
33 0.48
34 0.47
35 0.48
36 0.45
37 0.45
38 0.44
39 0.42
40 0.39
41 0.39
42 0.41
43 0.44
44 0.54
45 0.6
46 0.67
47 0.68
48 0.69
49 0.71
50 0.76
51 0.77
52 0.77
53 0.8
54 0.81
55 0.82
56 0.84
57 0.84
58 0.83
59 0.82
60 0.83
61 0.79
62 0.78
63 0.77
64 0.77
65 0.77
66 0.77
67 0.71
68 0.66
69 0.66
70 0.6
71 0.61
72 0.62
73 0.63
74 0.62
75 0.67
76 0.7
77 0.66
78 0.71
79 0.65
80 0.62
81 0.63
82 0.6
83 0.61
84 0.55
85 0.51
86 0.48
87 0.47
88 0.41
89 0.39
90 0.43
91 0.44
92 0.5
93 0.58
94 0.61
95 0.65
96 0.64
97 0.64
98 0.63
99 0.62
100 0.6
101 0.55
102 0.52
103 0.52
104 0.52
105 0.48
106 0.41
107 0.33
108 0.28
109 0.3
110 0.31
111 0.28
112 0.27
113 0.3
114 0.37
115 0.45
116 0.55
117 0.59
118 0.64
119 0.7
120 0.75
121 0.77
122 0.79
123 0.8
124 0.8
125 0.76
126 0.68
127 0.63
128 0.57
129 0.48
130 0.37
131 0.27
132 0.19
133 0.14
134 0.12
135 0.09
136 0.08
137 0.08
138 0.1
139 0.1
140 0.13
141 0.16
142 0.23
143 0.3
144 0.32
145 0.4
146 0.48
147 0.57
148 0.63
149 0.71
150 0.75
151 0.77
152 0.85
153 0.88
154 0.9
155 0.87
156 0.82
157 0.81
158 0.79
159 0.8
160 0.8
161 0.78
162 0.77
163 0.78
164 0.79
165 0.79
166 0.76
167 0.74
168 0.71
169 0.71
170 0.7
171 0.7
172 0.72
173 0.66
174 0.65
175 0.61
176 0.55
177 0.46
178 0.43
179 0.44
180 0.37
181 0.35
182 0.33
183 0.33
184 0.39
185 0.4
186 0.36
187 0.3
188 0.31
189 0.33
190 0.34
191 0.34
192 0.29
193 0.31
194 0.36
195 0.33
196 0.32
197 0.32
198 0.28
199 0.27
200 0.26
201 0.25
202 0.24
203 0.27
204 0.26
205 0.24
206 0.25
207 0.27
208 0.28
209 0.26
210 0.2
211 0.17
212 0.22
213 0.25
214 0.29
215 0.29
216 0.33
217 0.35
218 0.4
219 0.41
220 0.35
221 0.34
222 0.33
223 0.34
224 0.36
225 0.43
226 0.44
227 0.47
228 0.5
229 0.52
230 0.54
231 0.52
232 0.53
233 0.51
234 0.49
235 0.46
236 0.42
237 0.42
238 0.36
239 0.33
240 0.26
241 0.19
242 0.16
243 0.18
244 0.19
245 0.17
246 0.18
247 0.23
248 0.24
249 0.25
250 0.29
251 0.26
252 0.25
253 0.23