Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5FIB9

Protein Details
Accession V5FIB9    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-74YLIAKRRQWRVREKIRRSARRVGEHydrophilic
NLS Segment(s)
PositionSequence
55-88KRRQWRVREKIRRSARRVGEAIRTPLTPRFAKSA
Subcellular Location(s) extr 6, cyto_nucl 6, nucl 5.5, cyto 5.5, plas 5, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSNQDSIAAQNAAGASGTDDGSSGLSTTALAILITIVGVVVILGVTSAFLYLIAKRRQWRVREKIRRSARRVGEAIRTPLTPRFAKSARSPLPQSANRDRKAGFRDKASSSLAPVKEEGHQEQRFKSTKRSNTGTGAVRTEIYSKNKSGRDLDVEKGLELQPIKATSVVITAADSNSVDNGSVPVRKGWGSMFSFGRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.08
4 0.09
5 0.07
6 0.07
7 0.07
8 0.08
9 0.08
10 0.07
11 0.06
12 0.05
13 0.05
14 0.06
15 0.06
16 0.05
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.03
37 0.04
38 0.07
39 0.15
40 0.18
41 0.23
42 0.27
43 0.36
44 0.43
45 0.5
46 0.58
47 0.61
48 0.69
49 0.76
50 0.79
51 0.81
52 0.84
53 0.86
54 0.82
55 0.81
56 0.74
57 0.7
58 0.65
59 0.58
60 0.54
61 0.48
62 0.45
63 0.37
64 0.33
65 0.27
66 0.28
67 0.29
68 0.22
69 0.2
70 0.23
71 0.23
72 0.26
73 0.28
74 0.36
75 0.36
76 0.39
77 0.39
78 0.37
79 0.44
80 0.44
81 0.47
82 0.48
83 0.51
84 0.48
85 0.49
86 0.46
87 0.43
88 0.45
89 0.46
90 0.38
91 0.33
92 0.36
93 0.35
94 0.38
95 0.35
96 0.3
97 0.24
98 0.28
99 0.25
100 0.21
101 0.2
102 0.18
103 0.18
104 0.21
105 0.22
106 0.25
107 0.28
108 0.29
109 0.3
110 0.36
111 0.38
112 0.37
113 0.43
114 0.43
115 0.47
116 0.53
117 0.56
118 0.53
119 0.52
120 0.56
121 0.52
122 0.45
123 0.39
124 0.33
125 0.28
126 0.25
127 0.24
128 0.24
129 0.24
130 0.25
131 0.26
132 0.33
133 0.35
134 0.38
135 0.38
136 0.36
137 0.39
138 0.39
139 0.38
140 0.37
141 0.35
142 0.32
143 0.31
144 0.27
145 0.22
146 0.19
147 0.18
148 0.15
149 0.15
150 0.16
151 0.14
152 0.14
153 0.11
154 0.12
155 0.12
156 0.09
157 0.09
158 0.09
159 0.09
160 0.1
161 0.09
162 0.08
163 0.08
164 0.08
165 0.08
166 0.07
167 0.09
168 0.11
169 0.13
170 0.14
171 0.15
172 0.17
173 0.17
174 0.18
175 0.19
176 0.24
177 0.25
178 0.29