Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5FSC4

Protein Details
Accession V5FSC4    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
153-173MMIRSSKKKAAKAKAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
157-173SSKKKAAKAKAAAKKKA
Subcellular Location(s) plas 19, nucl 2, E.R. 2, mito 1, cyto 1, pero 1, golg 1, cyto_mito 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MIDRDDPGLRSLPYPRRNPETRELERLFSRPGESKVVSAEAAKEVGPALSAAVGHVRKRRELQEKVNPSCLLVDSIVAHSLTVIMLGQLVGSAMLLVATAIFLYYTAWTLLMPFVDPGHPLHDLFPPRVWAIRIPVILTLLGSAVVGSFLGVMMIRSSKKKAAKAKAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.59
4 0.64
5 0.68
6 0.69
7 0.69
8 0.66
9 0.68
10 0.64
11 0.6
12 0.57
13 0.53
14 0.46
15 0.37
16 0.35
17 0.3
18 0.3
19 0.32
20 0.3
21 0.28
22 0.27
23 0.27
24 0.23
25 0.2
26 0.18
27 0.13
28 0.13
29 0.12
30 0.1
31 0.08
32 0.08
33 0.07
34 0.06
35 0.05
36 0.04
37 0.04
38 0.04
39 0.09
40 0.11
41 0.14
42 0.19
43 0.21
44 0.23
45 0.28
46 0.36
47 0.4
48 0.46
49 0.52
50 0.58
51 0.66
52 0.65
53 0.66
54 0.58
55 0.49
56 0.42
57 0.34
58 0.24
59 0.15
60 0.12
61 0.08
62 0.08
63 0.09
64 0.08
65 0.07
66 0.05
67 0.05
68 0.04
69 0.04
70 0.03
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.02
89 0.02
90 0.03
91 0.03
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.06
102 0.06
103 0.07
104 0.08
105 0.1
106 0.11
107 0.11
108 0.12
109 0.17
110 0.19
111 0.2
112 0.2
113 0.2
114 0.2
115 0.22
116 0.21
117 0.18
118 0.21
119 0.24
120 0.23
121 0.21
122 0.21
123 0.2
124 0.19
125 0.17
126 0.12
127 0.07
128 0.06
129 0.05
130 0.04
131 0.03
132 0.04
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.04
140 0.05
141 0.08
142 0.11
143 0.15
144 0.19
145 0.26
146 0.33
147 0.41
148 0.5
149 0.57
150 0.65
151 0.72
152 0.79
153 0.81