Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5FM19

Protein Details
Accession V5FM19    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
144-166TDEKLRPLIRRARENRQKRLSAEHydrophilic
NLS Segment(s)
PositionSequence
153-162RRARENRQKR
Subcellular Location(s) mito_nucl 9.666, nucl 9.5, mito 9.5, cyto_nucl 7.833, cyto_mito 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR032710  NTF2-like_dom_sf  
Amino Acid Sequences MWKQQQTTPNKRRETAEKFISIFGTLDTQLLDSLLAEDFVHQFAPASLGLREPLGKQVFLEHIGGIREIMVGFPVTANEYIENESGNQVTVWATSLANFREDVKDDGVSEKEWAYEGEYMFLVFMNETGEKITRVIEFLDSKATDEKLRPLIRRARENRQKRLSAESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.68
3 0.66
4 0.61
5 0.56
6 0.54
7 0.49
8 0.39
9 0.31
10 0.23
11 0.18
12 0.13
13 0.11
14 0.1
15 0.1
16 0.09
17 0.08
18 0.08
19 0.05
20 0.06
21 0.05
22 0.06
23 0.05
24 0.06
25 0.07
26 0.07
27 0.07
28 0.06
29 0.06
30 0.06
31 0.08
32 0.07
33 0.08
34 0.08
35 0.08
36 0.09
37 0.09
38 0.1
39 0.09
40 0.15
41 0.15
42 0.15
43 0.14
44 0.16
45 0.17
46 0.18
47 0.18
48 0.11
49 0.11
50 0.11
51 0.11
52 0.09
53 0.08
54 0.06
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.08
68 0.08
69 0.08
70 0.07
71 0.07
72 0.07
73 0.07
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.09
83 0.09
84 0.1
85 0.1
86 0.11
87 0.12
88 0.14
89 0.14
90 0.14
91 0.14
92 0.14
93 0.15
94 0.15
95 0.14
96 0.13
97 0.11
98 0.09
99 0.09
100 0.09
101 0.09
102 0.11
103 0.11
104 0.11
105 0.11
106 0.1
107 0.1
108 0.1
109 0.08
110 0.05
111 0.05
112 0.06
113 0.06
114 0.06
115 0.08
116 0.09
117 0.09
118 0.1
119 0.11
120 0.1
121 0.1
122 0.11
123 0.14
124 0.15
125 0.15
126 0.2
127 0.18
128 0.2
129 0.22
130 0.23
131 0.21
132 0.22
133 0.27
134 0.31
135 0.37
136 0.38
137 0.43
138 0.51
139 0.56
140 0.65
141 0.67
142 0.69
143 0.74
144 0.81
145 0.83
146 0.84
147 0.82
148 0.75