Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5GEF4

Protein Details
Accession V5GEF4    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
72-92GLDRKAKREIRKLMRSRRVNFBasic
NLS Segment(s)
PositionSequence
75-88RKAKREIRKLMRSR
Subcellular Location(s) extr 17, cyto 4, nucl 3, mito 1, plas 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR018559  DUF2015  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF09435  DUF2015  
Amino Acid Sequences MGYYFLYSITLSVLIFGTGLYLTRSRWMPLIPLPDYLYDRLPSSFTDDIEAGFTSTDFDLSANVAEGDSRAGLDRKAKREIRKLMRSRRVNFDEARRLYTEQRFAKNNIGPDGRPRDPKFVSFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.05
6 0.06
7 0.07
8 0.08
9 0.08
10 0.12
11 0.14
12 0.14
13 0.16
14 0.16
15 0.18
16 0.21
17 0.27
18 0.24
19 0.26
20 0.26
21 0.26
22 0.27
23 0.26
24 0.23
25 0.17
26 0.17
27 0.15
28 0.15
29 0.13
30 0.18
31 0.17
32 0.15
33 0.16
34 0.15
35 0.15
36 0.15
37 0.14
38 0.08
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.03
53 0.04
54 0.04
55 0.03
56 0.04
57 0.04
58 0.05
59 0.06
60 0.14
61 0.2
62 0.24
63 0.32
64 0.38
65 0.44
66 0.53
67 0.62
68 0.65
69 0.7
70 0.75
71 0.77
72 0.82
73 0.84
74 0.79
75 0.79
76 0.74
77 0.69
78 0.64
79 0.62
80 0.62
81 0.55
82 0.54
83 0.46
84 0.44
85 0.45
86 0.46
87 0.47
88 0.43
89 0.47
90 0.47
91 0.48
92 0.54
93 0.51
94 0.5
95 0.47
96 0.45
97 0.4
98 0.45
99 0.5
100 0.48
101 0.54
102 0.53
103 0.55
104 0.54