Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5FWH3

Protein Details
Accession V5FWH3    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
136-166QDNAVVDKEERKRKKKERRLAEKRAKAKGAEBasic
NLS Segment(s)
PositionSequence
145-164ERKRKKKERRLAEKRAKAKG
Subcellular Location(s) nucl 19, mito 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MSAQGPSPLPPTTILSTKPISQSAAHDFLAAYLDRANTDPALQPNAVISERGPVSRTTAAAPNLILHNLKRVQAGLAGEVLGRDLTVAKLETETQAEEQAKNTTEGWIDKEQWQQEDEEGNPADAIEDEHQDLDVQDNAVVDKEERKRKKKERRLAEKRAKAKGAEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.29
4 0.32
5 0.33
6 0.3
7 0.28
8 0.26
9 0.29
10 0.31
11 0.32
12 0.29
13 0.26
14 0.24
15 0.22
16 0.23
17 0.18
18 0.12
19 0.09
20 0.09
21 0.1
22 0.11
23 0.12
24 0.1
25 0.11
26 0.14
27 0.15
28 0.18
29 0.17
30 0.16
31 0.15
32 0.18
33 0.16
34 0.13
35 0.11
36 0.12
37 0.13
38 0.14
39 0.14
40 0.12
41 0.16
42 0.17
43 0.18
44 0.15
45 0.19
46 0.2
47 0.19
48 0.19
49 0.16
50 0.15
51 0.15
52 0.14
53 0.1
54 0.14
55 0.15
56 0.16
57 0.15
58 0.15
59 0.14
60 0.15
61 0.15
62 0.1
63 0.09
64 0.08
65 0.07
66 0.07
67 0.06
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.04
76 0.05
77 0.06
78 0.06
79 0.07
80 0.08
81 0.07
82 0.11
83 0.12
84 0.12
85 0.13
86 0.14
87 0.14
88 0.15
89 0.14
90 0.12
91 0.12
92 0.13
93 0.16
94 0.17
95 0.18
96 0.21
97 0.25
98 0.26
99 0.26
100 0.26
101 0.22
102 0.21
103 0.21
104 0.18
105 0.18
106 0.16
107 0.15
108 0.14
109 0.13
110 0.12
111 0.09
112 0.11
113 0.08
114 0.09
115 0.09
116 0.09
117 0.1
118 0.1
119 0.1
120 0.1
121 0.09
122 0.08
123 0.08
124 0.09
125 0.09
126 0.09
127 0.1
128 0.09
129 0.15
130 0.23
131 0.33
132 0.43
133 0.52
134 0.62
135 0.73
136 0.83
137 0.87
138 0.89
139 0.9
140 0.92
141 0.94
142 0.94
143 0.95
144 0.93
145 0.91
146 0.89
147 0.82
148 0.73
149 0.67