Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5G025

Protein Details
Accession V5G025    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
31-53YSYPSRSPKSHPRSKPKVTDPAAHydrophilic
NLS Segment(s)
PositionSequence
155-169AKGGKSKKKGGKGKR
Subcellular Location(s) mito 13, cyto 10.5, cyto_nucl 7, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MPYLPTSQAFLEQSSLLLEAYPESTKITTRYSYPSRSPKSHPRSKPKVTDPAATDSTAQTTTTPIATLTLKTYHAPTGICLKYKTNKAAEVGRLITGLGKLAAGAKVKDLGTSAAAAAAPGGDVEMADAPSTAAATVDDSAAAATTAKTDSGTGAKGGKSKKKGGKGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.1
4 0.09
5 0.08
6 0.07
7 0.09
8 0.09
9 0.09
10 0.1
11 0.11
12 0.13
13 0.16
14 0.19
15 0.18
16 0.21
17 0.28
18 0.32
19 0.38
20 0.44
21 0.52
22 0.55
23 0.58
24 0.63
25 0.66
26 0.7
27 0.74
28 0.76
29 0.76
30 0.79
31 0.83
32 0.85
33 0.81
34 0.81
35 0.75
36 0.71
37 0.63
38 0.59
39 0.52
40 0.44
41 0.37
42 0.27
43 0.25
44 0.19
45 0.16
46 0.1
47 0.09
48 0.09
49 0.09
50 0.09
51 0.07
52 0.08
53 0.08
54 0.09
55 0.09
56 0.1
57 0.11
58 0.12
59 0.13
60 0.12
61 0.13
62 0.12
63 0.12
64 0.18
65 0.18
66 0.19
67 0.19
68 0.21
69 0.25
70 0.29
71 0.32
72 0.26
73 0.27
74 0.27
75 0.3
76 0.29
77 0.27
78 0.23
79 0.19
80 0.17
81 0.15
82 0.13
83 0.09
84 0.08
85 0.05
86 0.04
87 0.04
88 0.05
89 0.07
90 0.07
91 0.07
92 0.08
93 0.1
94 0.11
95 0.11
96 0.1
97 0.09
98 0.09
99 0.09
100 0.09
101 0.07
102 0.06
103 0.06
104 0.05
105 0.04
106 0.04
107 0.03
108 0.03
109 0.02
110 0.02
111 0.03
112 0.04
113 0.04
114 0.04
115 0.05
116 0.05
117 0.05
118 0.05
119 0.04
120 0.04
121 0.04
122 0.05
123 0.05
124 0.06
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.04
131 0.04
132 0.05
133 0.06
134 0.06
135 0.07
136 0.07
137 0.09
138 0.11
139 0.13
140 0.13
141 0.16
142 0.18
143 0.23
144 0.31
145 0.38
146 0.42
147 0.51
148 0.58
149 0.65