Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2AM97

Protein Details
Accession B2AM97    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
116-136GKVFTPPPTSKKRRRGETDPAHydrophilic
NLS Segment(s)
PositionSequence
127-128KR
Subcellular Location(s) mito 11, cyto 7, nucl 5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR017441  Protein_kinase_ATP_BS  
Gene Ontology GO:0005524  F:ATP binding  
KEGG pan:PODANSg2201  -  
PROSITE View protein in PROSITE  
PS00107  PROTEIN_KINASE_ATP  
Amino Acid Sequences MRIWLHNRYSTHGTAVGYNGQNEKEIRLNEMWILAFDPGAESSFRLITVASSGLAILIEFSNHQGKEAHPAVTEPPSEAQTTSERLIYFKERKIGSGIFGRVFRLIRARDGQYFAGKVFTPPPTSKKRRRGETDPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.29
4 0.24
5 0.25
6 0.24
7 0.22
8 0.24
9 0.23
10 0.23
11 0.22
12 0.21
13 0.24
14 0.22
15 0.23
16 0.2
17 0.22
18 0.19
19 0.14
20 0.14
21 0.09
22 0.08
23 0.07
24 0.07
25 0.06
26 0.07
27 0.07
28 0.06
29 0.07
30 0.08
31 0.08
32 0.07
33 0.06
34 0.06
35 0.07
36 0.07
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.04
43 0.04
44 0.03
45 0.03
46 0.04
47 0.06
48 0.09
49 0.09
50 0.1
51 0.1
52 0.11
53 0.17
54 0.19
55 0.18
56 0.14
57 0.15
58 0.16
59 0.17
60 0.17
61 0.11
62 0.11
63 0.11
64 0.11
65 0.11
66 0.12
67 0.12
68 0.14
69 0.14
70 0.15
71 0.14
72 0.14
73 0.17
74 0.22
75 0.25
76 0.25
77 0.31
78 0.29
79 0.3
80 0.33
81 0.31
82 0.27
83 0.28
84 0.28
85 0.24
86 0.25
87 0.25
88 0.23
89 0.23
90 0.21
91 0.22
92 0.21
93 0.24
94 0.28
95 0.31
96 0.31
97 0.35
98 0.36
99 0.33
100 0.32
101 0.28
102 0.25
103 0.22
104 0.2
105 0.21
106 0.22
107 0.24
108 0.27
109 0.35
110 0.43
111 0.53
112 0.62
113 0.68
114 0.75
115 0.79
116 0.84