Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5FWK1

Protein Details
Accession V5FWK1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-40SSARIKRNRKTGQIKFKVRCHydrophilic
NLS Segment(s)
PositionSequence
23-30ARIKRNRK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVSDIKQFIEISRRKDASSARIKRNRKTGQIKFKVRCQRFLYTLSLKDSDKADKLKQSLPPCELHPNILKYAAPVPIPLRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.4
3 0.4
4 0.37
5 0.41
6 0.43
7 0.43
8 0.49
9 0.52
10 0.54
11 0.62
12 0.67
13 0.69
14 0.76
15 0.73
16 0.73
17 0.74
18 0.74
19 0.76
20 0.8
21 0.83
22 0.76
23 0.78
24 0.78
25 0.69
26 0.67
27 0.61
28 0.55
29 0.48
30 0.48
31 0.45
32 0.39
33 0.39
34 0.34
35 0.31
36 0.27
37 0.26
38 0.25
39 0.22
40 0.22
41 0.24
42 0.24
43 0.27
44 0.3
45 0.33
46 0.38
47 0.41
48 0.43
49 0.43
50 0.42
51 0.4
52 0.45
53 0.41
54 0.4
55 0.4
56 0.37
57 0.36
58 0.35
59 0.32
60 0.26
61 0.28
62 0.27
63 0.21
64 0.21