Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5G3B4

Protein Details
Accession V5G3B4    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-68LKIRPSKPYRHPILDKRLTRBasic
NLS Segment(s)
Subcellular Location(s) cyto 14, mito 9, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022495  Bud32  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR008266  Tyr_kinase_AS  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0006468  P:protein phosphorylation  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF06293  Kdo  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
PS00109  PROTEIN_KINASE_TYR  
Amino Acid Sequences MAPEQSPYAPPALPAPFTNTTPPPALLTQGAEAHLYKTTFLTPSTPAALKIRPSKPYRHPILDKRLTRQRVLQEARCLVKLVREGVKVPGVLAVDWEAQGGENGRVAAWLLMEWIDGLVLRVVFERWEAWIKQQQRELSESDFARLHEEEAERVRGLMRRIGHTIGGMHKAGVIHGDLTTSNLILRPTQNADTASAEIASTSPPAMDGEVVLIDFGLAGQSVQDEDRAVDLYVLERAFGSTHPKTEGFFEEVVKAYGESYRGANVVLKRLEDVRMRGRKRSMIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.28
4 0.3
5 0.35
6 0.31
7 0.32
8 0.33
9 0.33
10 0.29
11 0.26
12 0.27
13 0.22
14 0.22
15 0.21
16 0.2
17 0.2
18 0.18
19 0.17
20 0.16
21 0.18
22 0.16
23 0.14
24 0.14
25 0.15
26 0.15
27 0.15
28 0.17
29 0.16
30 0.18
31 0.22
32 0.21
33 0.21
34 0.24
35 0.26
36 0.3
37 0.37
38 0.4
39 0.44
40 0.48
41 0.54
42 0.6
43 0.67
44 0.69
45 0.68
46 0.72
47 0.73
48 0.8
49 0.8
50 0.75
51 0.73
52 0.75
53 0.7
54 0.63
55 0.6
56 0.56
57 0.57
58 0.6
59 0.57
60 0.54
61 0.56
62 0.55
63 0.49
64 0.44
65 0.33
66 0.31
67 0.28
68 0.25
69 0.25
70 0.24
71 0.25
72 0.26
73 0.28
74 0.24
75 0.21
76 0.18
77 0.14
78 0.12
79 0.12
80 0.11
81 0.09
82 0.09
83 0.09
84 0.06
85 0.06
86 0.06
87 0.07
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.04
108 0.04
109 0.04
110 0.05
111 0.05
112 0.05
113 0.06
114 0.1
115 0.1
116 0.13
117 0.2
118 0.23
119 0.27
120 0.3
121 0.31
122 0.3
123 0.32
124 0.3
125 0.25
126 0.26
127 0.22
128 0.2
129 0.19
130 0.17
131 0.17
132 0.15
133 0.14
134 0.12
135 0.13
136 0.12
137 0.13
138 0.15
139 0.12
140 0.12
141 0.13
142 0.13
143 0.13
144 0.15
145 0.15
146 0.17
147 0.19
148 0.19
149 0.18
150 0.16
151 0.17
152 0.16
153 0.17
154 0.14
155 0.12
156 0.12
157 0.12
158 0.11
159 0.1
160 0.08
161 0.06
162 0.06
163 0.06
164 0.05
165 0.07
166 0.07
167 0.06
168 0.06
169 0.07
170 0.08
171 0.09
172 0.1
173 0.11
174 0.14
175 0.16
176 0.18
177 0.17
178 0.19
179 0.19
180 0.19
181 0.16
182 0.13
183 0.11
184 0.09
185 0.08
186 0.07
187 0.06
188 0.05
189 0.04
190 0.05
191 0.05
192 0.06
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.04
200 0.04
201 0.03
202 0.03
203 0.02
204 0.02
205 0.02
206 0.02
207 0.03
208 0.04
209 0.04
210 0.05
211 0.05
212 0.06
213 0.07
214 0.08
215 0.08
216 0.08
217 0.08
218 0.08
219 0.11
220 0.1
221 0.1
222 0.08
223 0.09
224 0.09
225 0.1
226 0.18
227 0.17
228 0.19
229 0.22
230 0.23
231 0.24
232 0.27
233 0.29
234 0.25
235 0.25
236 0.24
237 0.23
238 0.23
239 0.23
240 0.2
241 0.16
242 0.13
243 0.14
244 0.13
245 0.12
246 0.12
247 0.13
248 0.13
249 0.14
250 0.18
251 0.19
252 0.25
253 0.26
254 0.25
255 0.26
256 0.28
257 0.32
258 0.33
259 0.37
260 0.4
261 0.48
262 0.51
263 0.57
264 0.61