Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5F6U9

Protein Details
Accession V5F6U9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
313-340GSRERAKALERKRKKIAGKERKEMPWGRBasic
NLS Segment(s)
PositionSequence
245-358QKEELKRKIRSTADRLRAIEDKKREEEIVAEHKKREKELIREGKKTTPYFLKKSDIKREMLKKKYEAMGSRERAKALERKRKKIAGKERKEMPWGRRGMEADMGAGGGGGKRRR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MGLSDALNRRVRARPQEDEEIYSDLSASDESGEEVSGSEEETDGSDISDAELENDEDDSSQNEDKSDDDSDNEDEDEDEDEDEDEEDGEEDIQSTLNNISFGALAKAQDSFGKRKPSSSTTSKPSSNTNSTVEDIRARLREAREKKLQESAKSSGKDASKLSRSSKHAPQIQSSKHAVSRRRIVVETPAAAKPRDPRFDPTVLSHSGARSNPSAANKAYSFLDEYRASELKELKQQFAKTKNPAQKEELKRKIRSTADRLRAIEDKKREEEIVAEHKKREKELIREGKKTTPYFLKKSDIKREMLKKKYEAMGSRERAKALERKRKKIAGKERKEMPWGRRGMEADMGAGGGGGKRRRTEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.61
3 0.7
4 0.68
5 0.64
6 0.58
7 0.51
8 0.43
9 0.34
10 0.27
11 0.17
12 0.15
13 0.11
14 0.09
15 0.06
16 0.06
17 0.07
18 0.08
19 0.08
20 0.07
21 0.07
22 0.08
23 0.07
24 0.08
25 0.07
26 0.07
27 0.07
28 0.08
29 0.09
30 0.07
31 0.08
32 0.07
33 0.07
34 0.08
35 0.09
36 0.07
37 0.08
38 0.09
39 0.09
40 0.09
41 0.1
42 0.09
43 0.08
44 0.09
45 0.09
46 0.11
47 0.13
48 0.13
49 0.13
50 0.14
51 0.14
52 0.17
53 0.18
54 0.15
55 0.14
56 0.17
57 0.18
58 0.19
59 0.18
60 0.15
61 0.13
62 0.13
63 0.13
64 0.11
65 0.09
66 0.08
67 0.08
68 0.08
69 0.09
70 0.08
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.08
89 0.09
90 0.08
91 0.08
92 0.08
93 0.09
94 0.09
95 0.12
96 0.15
97 0.19
98 0.24
99 0.34
100 0.34
101 0.37
102 0.42
103 0.43
104 0.47
105 0.5
106 0.5
107 0.47
108 0.53
109 0.52
110 0.48
111 0.49
112 0.48
113 0.44
114 0.41
115 0.38
116 0.35
117 0.33
118 0.33
119 0.28
120 0.23
121 0.2
122 0.2
123 0.18
124 0.17
125 0.2
126 0.22
127 0.3
128 0.34
129 0.4
130 0.46
131 0.47
132 0.48
133 0.53
134 0.53
135 0.47
136 0.47
137 0.44
138 0.42
139 0.4
140 0.39
141 0.35
142 0.33
143 0.32
144 0.28
145 0.29
146 0.27
147 0.3
148 0.33
149 0.35
150 0.39
151 0.42
152 0.47
153 0.48
154 0.49
155 0.48
156 0.5
157 0.5
158 0.47
159 0.46
160 0.42
161 0.36
162 0.35
163 0.38
164 0.37
165 0.35
166 0.4
167 0.38
168 0.39
169 0.38
170 0.34
171 0.34
172 0.31
173 0.28
174 0.23
175 0.21
176 0.2
177 0.2
178 0.21
179 0.23
180 0.27
181 0.3
182 0.3
183 0.33
184 0.36
185 0.39
186 0.39
187 0.34
188 0.31
189 0.29
190 0.27
191 0.23
192 0.19
193 0.2
194 0.19
195 0.18
196 0.15
197 0.16
198 0.18
199 0.19
200 0.21
201 0.18
202 0.21
203 0.19
204 0.2
205 0.18
206 0.16
207 0.16
208 0.13
209 0.18
210 0.15
211 0.16
212 0.19
213 0.19
214 0.19
215 0.19
216 0.22
217 0.2
218 0.28
219 0.28
220 0.27
221 0.31
222 0.34
223 0.38
224 0.42
225 0.46
226 0.45
227 0.52
228 0.56
229 0.57
230 0.58
231 0.56
232 0.59
233 0.62
234 0.66
235 0.68
236 0.69
237 0.68
238 0.67
239 0.69
240 0.67
241 0.65
242 0.64
243 0.64
244 0.64
245 0.66
246 0.64
247 0.6
248 0.58
249 0.54
250 0.52
251 0.48
252 0.46
253 0.43
254 0.45
255 0.41
256 0.35
257 0.34
258 0.33
259 0.36
260 0.39
261 0.38
262 0.39
263 0.45
264 0.47
265 0.46
266 0.49
267 0.46
268 0.46
269 0.54
270 0.62
271 0.64
272 0.67
273 0.68
274 0.66
275 0.67
276 0.59
277 0.54
278 0.53
279 0.53
280 0.54
281 0.55
282 0.57
283 0.57
284 0.65
285 0.7
286 0.65
287 0.62
288 0.65
289 0.71
290 0.73
291 0.73
292 0.72
293 0.64
294 0.65
295 0.67
296 0.64
297 0.6
298 0.57
299 0.59
300 0.57
301 0.6
302 0.56
303 0.51
304 0.46
305 0.46
306 0.48
307 0.48
308 0.54
309 0.56
310 0.63
311 0.71
312 0.78
313 0.81
314 0.83
315 0.84
316 0.84
317 0.84
318 0.84
319 0.84
320 0.8
321 0.81
322 0.78
323 0.73
324 0.71
325 0.65
326 0.58
327 0.56
328 0.52
329 0.47
330 0.45
331 0.38
332 0.3
333 0.25
334 0.23
335 0.17
336 0.14
337 0.11
338 0.08
339 0.13
340 0.17
341 0.2