Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5FU29

Protein Details
Accession V5FU29    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
125-155KPSNDEEKKKQPGRPKKAKEVSKKPTPRSADBasic
NLS Segment(s)
PositionSequence
132-164KKKQPGRPKKAKEVSKKPTPRSADGIGSRTRSR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MATEEVPIEAPATASEANDVPGAQEQNGPTTDIESQPKSPRVTDESKLNGNSGTPEEPEISQSQTAGDNEEPKTGEKRPIDGSNNPATGNENGAENGASSEKKQKTEQPSEAESGPIDPSATDGKPSNDEEKKKQPGRPKKAKEVSKKPTPRSADGIGSRTRSRTKAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.1
4 0.11
5 0.12
6 0.11
7 0.09
8 0.13
9 0.14
10 0.13
11 0.15
12 0.15
13 0.17
14 0.18
15 0.19
16 0.15
17 0.16
18 0.17
19 0.18
20 0.22
21 0.22
22 0.26
23 0.3
24 0.36
25 0.35
26 0.35
27 0.35
28 0.37
29 0.4
30 0.39
31 0.4
32 0.4
33 0.42
34 0.42
35 0.38
36 0.32
37 0.26
38 0.24
39 0.19
40 0.16
41 0.12
42 0.13
43 0.13
44 0.13
45 0.15
46 0.14
47 0.13
48 0.12
49 0.11
50 0.11
51 0.12
52 0.12
53 0.12
54 0.12
55 0.14
56 0.14
57 0.16
58 0.16
59 0.15
60 0.18
61 0.17
62 0.23
63 0.2
64 0.22
65 0.25
66 0.29
67 0.32
68 0.32
69 0.35
70 0.32
71 0.32
72 0.3
73 0.26
74 0.23
75 0.19
76 0.18
77 0.13
78 0.09
79 0.08
80 0.08
81 0.08
82 0.06
83 0.06
84 0.06
85 0.06
86 0.07
87 0.16
88 0.18
89 0.21
90 0.24
91 0.3
92 0.38
93 0.46
94 0.5
95 0.47
96 0.47
97 0.47
98 0.45
99 0.38
100 0.29
101 0.22
102 0.17
103 0.12
104 0.09
105 0.06
106 0.08
107 0.11
108 0.11
109 0.12
110 0.13
111 0.15
112 0.19
113 0.22
114 0.29
115 0.32
116 0.38
117 0.43
118 0.51
119 0.6
120 0.62
121 0.65
122 0.68
123 0.72
124 0.78
125 0.82
126 0.81
127 0.82
128 0.85
129 0.89
130 0.89
131 0.89
132 0.87
133 0.87
134 0.88
135 0.83
136 0.82
137 0.79
138 0.73
139 0.69
140 0.64
141 0.62
142 0.57
143 0.56
144 0.51
145 0.5
146 0.47
147 0.46
148 0.47