Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5FRA6

Protein Details
Accession V5FRA6    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
186-235GTPSKSKGKTPERDRDRERDRARRSLGRQHRERERERRRRWSGSEREFESBasic
NLS Segment(s)
PositionSequence
187-226TPSKSKGKTPERDRDRERDRARRSLGRQHRERERERRRRW
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSRSTALHPRDYRRPGQEEEDAIIIDDDNDDLMQIDAPETTPPAGQFHFHHQQQRQHQHQRMGYGHNPHDPSSITSDRARDTGRGYLTASAYEKKARSIHREGRHSALCVLSDRELLMIQALAAHETIPQTRRRFLAQLMAPDDPRAATAIRMDRFTAAGSSHPVPGTVIDVYEDDDAGWRRPDAGTPSKSKGKTPERDRDRERDRARRSLGRQHRERERERRRRWSGSEREFESQAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.63
3 0.63
4 0.61
5 0.54
6 0.49
7 0.42
8 0.34
9 0.28
10 0.23
11 0.17
12 0.11
13 0.09
14 0.06
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.07
26 0.08
27 0.08
28 0.09
29 0.09
30 0.12
31 0.12
32 0.15
33 0.17
34 0.24
35 0.32
36 0.35
37 0.42
38 0.46
39 0.54
40 0.62
41 0.69
42 0.71
43 0.73
44 0.76
45 0.75
46 0.71
47 0.69
48 0.62
49 0.59
50 0.53
51 0.51
52 0.47
53 0.45
54 0.45
55 0.38
56 0.36
57 0.31
58 0.28
59 0.27
60 0.26
61 0.23
62 0.24
63 0.25
64 0.25
65 0.26
66 0.25
67 0.2
68 0.2
69 0.22
70 0.21
71 0.2
72 0.2
73 0.2
74 0.19
75 0.19
76 0.18
77 0.15
78 0.15
79 0.18
80 0.17
81 0.19
82 0.23
83 0.26
84 0.32
85 0.39
86 0.47
87 0.51
88 0.56
89 0.55
90 0.55
91 0.52
92 0.46
93 0.38
94 0.29
95 0.22
96 0.17
97 0.16
98 0.12
99 0.1
100 0.09
101 0.08
102 0.08
103 0.07
104 0.06
105 0.04
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.07
115 0.09
116 0.15
117 0.17
118 0.19
119 0.21
120 0.23
121 0.24
122 0.24
123 0.29
124 0.25
125 0.28
126 0.28
127 0.28
128 0.26
129 0.24
130 0.23
131 0.15
132 0.13
133 0.1
134 0.07
135 0.06
136 0.1
137 0.16
138 0.17
139 0.18
140 0.18
141 0.18
142 0.18
143 0.18
144 0.15
145 0.09
146 0.09
147 0.12
148 0.13
149 0.14
150 0.13
151 0.13
152 0.12
153 0.12
154 0.13
155 0.1
156 0.08
157 0.08
158 0.08
159 0.09
160 0.09
161 0.09
162 0.07
163 0.1
164 0.11
165 0.12
166 0.13
167 0.11
168 0.12
169 0.12
170 0.16
171 0.2
172 0.27
173 0.31
174 0.36
175 0.42
176 0.49
177 0.5
178 0.51
179 0.54
180 0.55
181 0.6
182 0.64
183 0.69
184 0.7
185 0.78
186 0.81
187 0.81
188 0.78
189 0.79
190 0.78
191 0.78
192 0.76
193 0.76
194 0.77
195 0.76
196 0.75
197 0.76
198 0.77
199 0.77
200 0.79
201 0.79
202 0.82
203 0.82
204 0.85
205 0.85
206 0.86
207 0.87
208 0.88
209 0.9
210 0.89
211 0.88
212 0.88
213 0.87
214 0.87
215 0.86
216 0.84
217 0.79
218 0.74