Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5FC09

Protein Details
Accession V5FC09    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGQKHNRRRTRPRSRNLANKSVSHydrophilic
NLS Segment(s)
PositionSequence
8-11RRTR
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MGQKHNRRRTRPRSRNLANKSVSSTDSSLPPLNLVYTTDQTAYSAQSSPALSTACVSPSSFPVTLPPQWHDGYKEWRTRERRLRTEAAEMEAEQCRLFGGVPGDDVNLCYRMLEYFGGLDYIDSLGDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.88
4 0.87
5 0.79
6 0.71
7 0.65
8 0.57
9 0.49
10 0.41
11 0.35
12 0.27
13 0.26
14 0.26
15 0.23
16 0.2
17 0.19
18 0.16
19 0.14
20 0.13
21 0.13
22 0.13
23 0.12
24 0.13
25 0.13
26 0.13
27 0.13
28 0.14
29 0.13
30 0.11
31 0.1
32 0.09
33 0.11
34 0.11
35 0.1
36 0.11
37 0.1
38 0.09
39 0.09
40 0.09
41 0.08
42 0.08
43 0.08
44 0.08
45 0.09
46 0.13
47 0.12
48 0.11
49 0.13
50 0.16
51 0.18
52 0.19
53 0.19
54 0.19
55 0.2
56 0.21
57 0.21
58 0.21
59 0.27
60 0.32
61 0.36
62 0.36
63 0.43
64 0.48
65 0.54
66 0.61
67 0.63
68 0.63
69 0.65
70 0.67
71 0.61
72 0.63
73 0.55
74 0.48
75 0.39
76 0.32
77 0.28
78 0.24
79 0.21
80 0.14
81 0.12
82 0.09
83 0.09
84 0.08
85 0.08
86 0.09
87 0.09
88 0.1
89 0.11
90 0.12
91 0.11
92 0.12
93 0.12
94 0.11
95 0.1
96 0.09
97 0.09
98 0.09
99 0.11
100 0.11
101 0.09
102 0.09
103 0.09
104 0.1
105 0.09
106 0.09
107 0.08
108 0.07