Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5FW81

Protein Details
Accession V5FW81   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
184-206TMTFKRTPLDPPPKGKRRKTDDSHydrophilic
NLS Segment(s)
PositionSequence
196-202PKGKRRK
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MGQKKPVLHPLKTPKSATFPSEIHSSSSSELSARVKGEECNSTPITPPLAYTEFLKALTPVFTSPRSPSVGFSKLAPERSATVPTSQPSSATSTSFPAKESIKSASSLPPPSPFPQTQPARKRETLRRLRIPGSAACSPVTETPRSTTSLRSPFSPSEWKIRYFETPTSASGKPVSVRQVVTRTMTFKRTPLDPPPKGKRRKTDDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.6
3 0.61
4 0.55
5 0.5
6 0.41
7 0.38
8 0.4
9 0.36
10 0.32
11 0.29
12 0.28
13 0.23
14 0.24
15 0.2
16 0.15
17 0.17
18 0.16
19 0.18
20 0.17
21 0.17
22 0.17
23 0.2
24 0.23
25 0.26
26 0.25
27 0.29
28 0.3
29 0.28
30 0.29
31 0.28
32 0.27
33 0.22
34 0.2
35 0.19
36 0.19
37 0.19
38 0.19
39 0.2
40 0.18
41 0.18
42 0.18
43 0.13
44 0.12
45 0.12
46 0.12
47 0.1
48 0.12
49 0.13
50 0.15
51 0.17
52 0.19
53 0.22
54 0.22
55 0.23
56 0.26
57 0.27
58 0.26
59 0.24
60 0.28
61 0.27
62 0.28
63 0.26
64 0.22
65 0.21
66 0.23
67 0.25
68 0.19
69 0.18
70 0.18
71 0.19
72 0.21
73 0.18
74 0.16
75 0.15
76 0.18
77 0.17
78 0.16
79 0.16
80 0.15
81 0.17
82 0.17
83 0.16
84 0.14
85 0.14
86 0.14
87 0.15
88 0.16
89 0.15
90 0.16
91 0.16
92 0.18
93 0.2
94 0.21
95 0.2
96 0.19
97 0.21
98 0.22
99 0.26
100 0.22
101 0.22
102 0.3
103 0.35
104 0.42
105 0.48
106 0.52
107 0.54
108 0.58
109 0.62
110 0.62
111 0.67
112 0.68
113 0.68
114 0.71
115 0.69
116 0.66
117 0.62
118 0.55
119 0.47
120 0.42
121 0.35
122 0.28
123 0.23
124 0.22
125 0.2
126 0.21
127 0.22
128 0.18
129 0.17
130 0.19
131 0.2
132 0.23
133 0.23
134 0.23
135 0.28
136 0.35
137 0.35
138 0.34
139 0.37
140 0.35
141 0.39
142 0.43
143 0.37
144 0.4
145 0.42
146 0.42
147 0.4
148 0.41
149 0.42
150 0.38
151 0.39
152 0.34
153 0.33
154 0.32
155 0.35
156 0.33
157 0.29
158 0.26
159 0.25
160 0.22
161 0.24
162 0.27
163 0.25
164 0.27
165 0.3
166 0.33
167 0.34
168 0.36
169 0.35
170 0.35
171 0.35
172 0.4
173 0.37
174 0.36
175 0.37
176 0.37
177 0.4
178 0.46
179 0.53
180 0.54
181 0.63
182 0.7
183 0.76
184 0.82
185 0.85
186 0.85