Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5FXJ3

Protein Details
Accession V5FXJ3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
216-242GTIRKDKGYTGRKQRRRGFFGPRRSGSBasic
NLS Segment(s)
PositionSequence
226-235GRKQRRRGFF
Subcellular Location(s) plas 18, mito 4, extr 2, E.R. 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009571  SUR7/Rim9-like_fungi  
Gene Ontology GO:0005886  C:plasma membrane  
Pfam View protein in Pfam  
PF06687  SUR7  
Amino Acid Sequences MAAGRPLLGLLGLLLTAGALLLMFLTLLGGANNHRPLNEIYFLQAHTANIPGAPTESRWTFWSICSVNVRGHNVCGTSHPAFPLDPPSHRNFNTQTNIPRSFIGTNHFFLMTRFMFAFIIIALFFAVLSLFLGLLALCTRIGSFLSAFMGLIALTFQTITTALMTANPSISAAYVQGRDHFNGNGQRSHLGVKAFAFMWTATVCLFLASLLYCIGGTIRKDKGYTGRKQRRRGFFGPRRSGSTREYADGHDYADGAGRKETTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.02
13 0.03
14 0.03
15 0.03
16 0.04
17 0.06
18 0.12
19 0.17
20 0.18
21 0.18
22 0.21
23 0.23
24 0.27
25 0.28
26 0.23
27 0.21
28 0.23
29 0.23
30 0.22
31 0.21
32 0.16
33 0.14
34 0.15
35 0.12
36 0.1
37 0.1
38 0.09
39 0.09
40 0.1
41 0.1
42 0.14
43 0.15
44 0.16
45 0.18
46 0.22
47 0.21
48 0.21
49 0.27
50 0.23
51 0.26
52 0.28
53 0.28
54 0.28
55 0.31
56 0.35
57 0.28
58 0.29
59 0.27
60 0.23
61 0.22
62 0.2
63 0.22
64 0.2
65 0.2
66 0.19
67 0.18
68 0.17
69 0.18
70 0.23
71 0.2
72 0.21
73 0.24
74 0.29
75 0.33
76 0.34
77 0.38
78 0.34
79 0.39
80 0.41
81 0.41
82 0.43
83 0.44
84 0.45
85 0.41
86 0.38
87 0.33
88 0.29
89 0.25
90 0.24
91 0.2
92 0.19
93 0.19
94 0.19
95 0.16
96 0.15
97 0.19
98 0.14
99 0.12
100 0.11
101 0.11
102 0.11
103 0.11
104 0.11
105 0.05
106 0.06
107 0.04
108 0.04
109 0.03
110 0.03
111 0.03
112 0.03
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.04
128 0.04
129 0.05
130 0.05
131 0.05
132 0.06
133 0.06
134 0.05
135 0.05
136 0.05
137 0.04
138 0.04
139 0.03
140 0.02
141 0.02
142 0.03
143 0.02
144 0.03
145 0.03
146 0.04
147 0.04
148 0.04
149 0.04
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.06
156 0.06
157 0.06
158 0.05
159 0.05
160 0.07
161 0.09
162 0.09
163 0.13
164 0.14
165 0.15
166 0.17
167 0.16
168 0.19
169 0.24
170 0.27
171 0.25
172 0.25
173 0.25
174 0.24
175 0.26
176 0.23
177 0.17
178 0.16
179 0.14
180 0.15
181 0.15
182 0.14
183 0.13
184 0.1
185 0.11
186 0.09
187 0.09
188 0.07
189 0.08
190 0.07
191 0.06
192 0.06
193 0.05
194 0.05
195 0.05
196 0.06
197 0.05
198 0.05
199 0.05
200 0.05
201 0.06
202 0.09
203 0.1
204 0.15
205 0.19
206 0.21
207 0.22
208 0.25
209 0.34
210 0.4
211 0.48
212 0.54
213 0.62
214 0.69
215 0.79
216 0.85
217 0.86
218 0.85
219 0.84
220 0.84
221 0.82
222 0.84
223 0.84
224 0.79
225 0.76
226 0.71
227 0.68
228 0.6
229 0.6
230 0.52
231 0.45
232 0.43
233 0.39
234 0.4
235 0.36
236 0.32
237 0.24
238 0.21
239 0.17
240 0.21
241 0.19
242 0.16
243 0.17