Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2YPA6

Protein Details
Accession V2YPA6    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-31SHSATNGKLKKQTRKKRRTSVKQDTEERASHydrophilic
NLS Segment(s)
PositionSequence
9-19KLKKQTRKKRR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
KEGG mrr:Moror_1647  -  
Amino Acid Sequences MSHSATNGKLKKQTRKKRRTSVKQDTEERASISFENPGLYPGSHKEYGGGVRVVSRKAATAEKARPLLRVDDDDDFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.83
3 0.88
4 0.91
5 0.94
6 0.94
7 0.94
8 0.94
9 0.93
10 0.9
11 0.86
12 0.8
13 0.73
14 0.63
15 0.53
16 0.42
17 0.33
18 0.25
19 0.19
20 0.15
21 0.11
22 0.1
23 0.09
24 0.09
25 0.09
26 0.08
27 0.09
28 0.1
29 0.14
30 0.14
31 0.14
32 0.14
33 0.15
34 0.17
35 0.18
36 0.16
37 0.11
38 0.15
39 0.17
40 0.17
41 0.16
42 0.15
43 0.14
44 0.17
45 0.2
46 0.21
47 0.27
48 0.31
49 0.37
50 0.42
51 0.41
52 0.41
53 0.4
54 0.41
55 0.37
56 0.36
57 0.34