Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2XIH0

Protein Details
Accession V2XIH0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-41QPPNNTKRSRRVKAKANTVSSHydrophilic
NLS Segment(s)
PositionSequence
95-99KRRRR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
KEGG mrr:Moror_1641  -  
Amino Acid Sequences MAPSGSDNLLPIGNGKEAVSQPPNNTKRSRRVKAKANTVSSPVDADVSATASRRSSRSRKQISSPGDVSSPPVVRKGKGWVVVAERIPEDEQPSKRRRRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.14
4 0.14
5 0.2
6 0.24
7 0.24
8 0.28
9 0.38
10 0.42
11 0.43
12 0.49
13 0.51
14 0.56
15 0.64
16 0.69
17 0.69
18 0.73
19 0.78
20 0.79
21 0.83
22 0.81
23 0.75
24 0.67
25 0.6
26 0.53
27 0.43
28 0.36
29 0.25
30 0.17
31 0.12
32 0.1
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.09
40 0.11
41 0.17
42 0.24
43 0.32
44 0.42
45 0.5
46 0.54
47 0.58
48 0.64
49 0.63
50 0.62
51 0.55
52 0.46
53 0.38
54 0.34
55 0.31
56 0.27
57 0.24
58 0.18
59 0.23
60 0.24
61 0.23
62 0.25
63 0.3
64 0.31
65 0.34
66 0.36
67 0.33
68 0.36
69 0.4
70 0.39
71 0.34
72 0.29
73 0.26
74 0.26
75 0.23
76 0.24
77 0.27
78 0.32
79 0.39
80 0.48