Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2W5W8

Protein Details
Accession V2W5W8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
84-110DCPDAMKKEEKRKEEPKRLLKEERFAKBasic
NLS Segment(s)
PositionSequence
90-107KKEEKRKEEPKRLLKEER
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG mrr:Moror_14453  -  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MTRPEGTLMNIKDWMDAAILFDESYKQAQEYGKTWDEDNGRKPQQSFRKREEVAVKQISEADQKEYMAKRLCFQCSRGGHRIQDCPDAMKKEEKRKEEPKRLLKEERFAKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.14
3 0.12
4 0.11
5 0.09
6 0.09
7 0.08
8 0.08
9 0.08
10 0.09
11 0.1
12 0.09
13 0.08
14 0.11
15 0.13
16 0.16
17 0.17
18 0.22
19 0.24
20 0.24
21 0.25
22 0.26
23 0.29
24 0.3
25 0.34
26 0.36
27 0.35
28 0.37
29 0.38
30 0.41
31 0.48
32 0.53
33 0.55
34 0.52
35 0.59
36 0.57
37 0.61
38 0.61
39 0.55
40 0.53
41 0.49
42 0.43
43 0.34
44 0.34
45 0.29
46 0.24
47 0.2
48 0.15
49 0.12
50 0.13
51 0.16
52 0.17
53 0.21
54 0.23
55 0.23
56 0.25
57 0.29
58 0.34
59 0.32
60 0.33
61 0.37
62 0.38
63 0.45
64 0.47
65 0.46
66 0.47
67 0.49
68 0.54
69 0.48
70 0.48
71 0.41
72 0.39
73 0.4
74 0.38
75 0.36
76 0.4
77 0.44
78 0.49
79 0.57
80 0.59
81 0.63
82 0.71
83 0.79
84 0.81
85 0.84
86 0.83
87 0.85
88 0.87
89 0.88
90 0.83
91 0.82