Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5A5S3

Protein Details
Accession Q5A5S3   
Localization Confidence High
Confidence Score 19.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-25VDQQKPKKDPTVRPYKCPHCDKHydrophilic
63-93LTRHSRIHTNPNSRKNRKKKKEETTKAVSSPHydrophilic
189-208LDYVKHKLKRSRPNSPGPSTHydrophilic
NLS Segment(s)
PositionSequence
75-84SRKNRKKKKE
Subcellular Location(s) nucl 24, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0061987  P:negative regulation of transcription from RNA polymerase II promoter by glucose  
KEGG cal:CAALFM_C210540WA  -  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MSIVDQQKPKKDPTVRPYKCPHCDKAFQRLEHQTRHIRTHTGEKPHQCTFPGCSKRFSRSDELTRHSRIHTNPNSRKNRKKKKEETTKAVSSPSPPEATPKLPQLPKNPSTHSIDILASAATEELRMMESKSLPSLTDYFGKPPPKSNYDFSMKKPTFQFHDTTNLHHLSNLAFRMTPVKTHIQEDSDLDYVKHKLKRSRPNSPGPSTLPSSPVLGLSTNTTPSISASNSSTNLSSLGMIASFKPSMLHSQSSDALPSIKSLNLPEFNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.71
3 0.75
4 0.8
5 0.81
6 0.81
7 0.79
8 0.76
9 0.73
10 0.78
11 0.75
12 0.76
13 0.74
14 0.67
15 0.68
16 0.7
17 0.68
18 0.65
19 0.67
20 0.65
21 0.61
22 0.65
23 0.6
24 0.53
25 0.5
26 0.54
27 0.54
28 0.54
29 0.57
30 0.58
31 0.61
32 0.61
33 0.6
34 0.52
35 0.47
36 0.43
37 0.46
38 0.48
39 0.43
40 0.46
41 0.48
42 0.53
43 0.56
44 0.56
45 0.54
46 0.52
47 0.59
48 0.6
49 0.61
50 0.6
51 0.58
52 0.55
53 0.49
54 0.47
55 0.42
56 0.46
57 0.49
58 0.54
59 0.6
60 0.68
61 0.76
62 0.8
63 0.87
64 0.87
65 0.9
66 0.89
67 0.91
68 0.92
69 0.92
70 0.94
71 0.93
72 0.9
73 0.87
74 0.81
75 0.71
76 0.63
77 0.52
78 0.43
79 0.37
80 0.32
81 0.25
82 0.2
83 0.23
84 0.24
85 0.26
86 0.26
87 0.27
88 0.32
89 0.34
90 0.39
91 0.42
92 0.47
93 0.49
94 0.51
95 0.5
96 0.46
97 0.48
98 0.45
99 0.38
100 0.32
101 0.26
102 0.22
103 0.19
104 0.15
105 0.08
106 0.07
107 0.06
108 0.04
109 0.04
110 0.03
111 0.03
112 0.04
113 0.04
114 0.05
115 0.06
116 0.07
117 0.07
118 0.08
119 0.08
120 0.07
121 0.09
122 0.1
123 0.1
124 0.13
125 0.13
126 0.15
127 0.2
128 0.24
129 0.23
130 0.29
131 0.32
132 0.33
133 0.37
134 0.37
135 0.37
136 0.41
137 0.43
138 0.4
139 0.46
140 0.42
141 0.42
142 0.41
143 0.38
144 0.35
145 0.35
146 0.33
147 0.24
148 0.34
149 0.31
150 0.31
151 0.33
152 0.3
153 0.27
154 0.26
155 0.24
156 0.16
157 0.18
158 0.16
159 0.12
160 0.1
161 0.1
162 0.15
163 0.14
164 0.15
165 0.15
166 0.21
167 0.22
168 0.25
169 0.26
170 0.24
171 0.25
172 0.25
173 0.25
174 0.2
175 0.19
176 0.17
177 0.17
178 0.18
179 0.23
180 0.26
181 0.28
182 0.35
183 0.44
184 0.55
185 0.61
186 0.69
187 0.71
188 0.77
189 0.8
190 0.77
191 0.73
192 0.66
193 0.62
194 0.54
195 0.48
196 0.39
197 0.32
198 0.28
199 0.23
200 0.2
201 0.16
202 0.13
203 0.13
204 0.14
205 0.15
206 0.14
207 0.15
208 0.14
209 0.13
210 0.13
211 0.16
212 0.13
213 0.13
214 0.14
215 0.17
216 0.19
217 0.2
218 0.19
219 0.17
220 0.17
221 0.15
222 0.13
223 0.1
224 0.09
225 0.08
226 0.08
227 0.08
228 0.11
229 0.1
230 0.1
231 0.11
232 0.12
233 0.18
234 0.22
235 0.25
236 0.24
237 0.28
238 0.31
239 0.31
240 0.31
241 0.25
242 0.22
243 0.19
244 0.19
245 0.16
246 0.15
247 0.16
248 0.18
249 0.25