Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2XZ08

Protein Details
Accession V2XZ08    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-28LPERSGSSTKRCRKSKAQILSRSICLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001128  Cyt_P450  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
KEGG mrr:Moror_17371  -  
Pfam View protein in Pfam  
PF00067  p450  
Amino Acid Sequences MWLPERSGSSTKRCRKSKAQILSRSICLAQSWSWSIHLKRTKSCLRSDQLFIPTGQDSPWLNELVGMTFNFAFMKYGDWWREIGEKFLRAIAAAGNSTQFLVDQLPILKYLPGWLLAHVLGATAEGIAKSCVATKVLSALEAEGKRDLNREKILRNVLGTMYTAGTDTIIESFILAMVQNPEIMKPRQAAVDKIIGDERLPEFTDRRSIPCVDAILKETMVNAFQPPLHEGNESLGGTRLRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.83
4 0.83
5 0.84
6 0.84
7 0.83
8 0.85
9 0.82
10 0.73
11 0.65
12 0.55
13 0.45
14 0.35
15 0.28
16 0.21
17 0.2
18 0.2
19 0.18
20 0.21
21 0.26
22 0.27
23 0.33
24 0.4
25 0.4
26 0.43
27 0.51
28 0.57
29 0.56
30 0.62
31 0.61
32 0.6
33 0.61
34 0.59
35 0.57
36 0.51
37 0.48
38 0.41
39 0.35
40 0.29
41 0.24
42 0.2
43 0.17
44 0.14
45 0.16
46 0.18
47 0.16
48 0.15
49 0.15
50 0.16
51 0.13
52 0.13
53 0.1
54 0.1
55 0.09
56 0.09
57 0.08
58 0.08
59 0.08
60 0.07
61 0.09
62 0.1
63 0.15
64 0.17
65 0.18
66 0.18
67 0.18
68 0.24
69 0.22
70 0.24
71 0.22
72 0.22
73 0.21
74 0.21
75 0.2
76 0.14
77 0.14
78 0.1
79 0.08
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.06
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06
91 0.07
92 0.07
93 0.08
94 0.08
95 0.07
96 0.06
97 0.07
98 0.07
99 0.08
100 0.08
101 0.08
102 0.09
103 0.08
104 0.09
105 0.07
106 0.06
107 0.04
108 0.04
109 0.04
110 0.02
111 0.03
112 0.02
113 0.03
114 0.03
115 0.03
116 0.03
117 0.04
118 0.05
119 0.06
120 0.06
121 0.06
122 0.09
123 0.09
124 0.09
125 0.08
126 0.08
127 0.12
128 0.13
129 0.14
130 0.12
131 0.13
132 0.13
133 0.17
134 0.18
135 0.18
136 0.24
137 0.26
138 0.27
139 0.32
140 0.36
141 0.33
142 0.32
143 0.28
144 0.22
145 0.2
146 0.18
147 0.13
148 0.09
149 0.08
150 0.08
151 0.06
152 0.06
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.04
161 0.05
162 0.04
163 0.05
164 0.06
165 0.06
166 0.07
167 0.07
168 0.09
169 0.13
170 0.15
171 0.17
172 0.17
173 0.18
174 0.23
175 0.25
176 0.26
177 0.25
178 0.3
179 0.27
180 0.28
181 0.28
182 0.22
183 0.2
184 0.21
185 0.19
186 0.15
187 0.16
188 0.17
189 0.17
190 0.19
191 0.27
192 0.25
193 0.28
194 0.29
195 0.3
196 0.3
197 0.31
198 0.32
199 0.27
200 0.27
201 0.27
202 0.25
203 0.23
204 0.21
205 0.19
206 0.17
207 0.15
208 0.14
209 0.12
210 0.12
211 0.12
212 0.14
213 0.18
214 0.19
215 0.2
216 0.2
217 0.2
218 0.22
219 0.27
220 0.25
221 0.21
222 0.23