Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V2XYS8

Protein Details
Accession V2XYS8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
154-175VGSVGFWLRKRRKNKAPVEEEGHydrophilic
NLS Segment(s)
PositionSequence
163-166KRRK
Subcellular Location(s) nucl 10, cyto_nucl 9, cyto 6, mito 5, pero 2, plas 1, extr 1, E.R. 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mrr:Moror_6101  -  
Amino Acid Sequences MTLQPVDLYSADVSTDGNWPKRDGGSRFATCSPSANLKIEFTFKGTYAEAQGKLNIKPGKRPGPNSNIFSVDGFIKQFSVQPTPYTNGTFKLSSSNPLPSGQHTLSISCTADLNEIELDSINYIPADTGSSAGLSKGAIAGVVVGVVCFVVLLVGSVGFWLRKRRKNKAPVEEEGHTTVPFQPPLDIIEGSGAPPPMASQKGSVTQVQPTFEPSPPPYPGPSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.16
3 0.19
4 0.24
5 0.25
6 0.27
7 0.3
8 0.34
9 0.41
10 0.37
11 0.39
12 0.43
13 0.44
14 0.46
15 0.46
16 0.44
17 0.37
18 0.37
19 0.34
20 0.32
21 0.32
22 0.31
23 0.3
24 0.29
25 0.3
26 0.3
27 0.28
28 0.24
29 0.22
30 0.19
31 0.2
32 0.19
33 0.18
34 0.19
35 0.23
36 0.21
37 0.21
38 0.24
39 0.24
40 0.24
41 0.3
42 0.31
43 0.27
44 0.33
45 0.41
46 0.47
47 0.5
48 0.56
49 0.57
50 0.62
51 0.68
52 0.64
53 0.58
54 0.5
55 0.45
56 0.38
57 0.31
58 0.23
59 0.17
60 0.14
61 0.11
62 0.09
63 0.09
64 0.11
65 0.12
66 0.15
67 0.14
68 0.16
69 0.18
70 0.2
71 0.22
72 0.22
73 0.2
74 0.19
75 0.21
76 0.19
77 0.17
78 0.19
79 0.18
80 0.19
81 0.2
82 0.2
83 0.19
84 0.2
85 0.2
86 0.17
87 0.22
88 0.19
89 0.2
90 0.17
91 0.17
92 0.16
93 0.17
94 0.15
95 0.1
96 0.1
97 0.08
98 0.08
99 0.07
100 0.07
101 0.06
102 0.06
103 0.05
104 0.05
105 0.05
106 0.04
107 0.04
108 0.04
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.04
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.03
144 0.03
145 0.04
146 0.07
147 0.17
148 0.25
149 0.34
150 0.43
151 0.53
152 0.63
153 0.72
154 0.81
155 0.82
156 0.81
157 0.79
158 0.78
159 0.7
160 0.63
161 0.56
162 0.46
163 0.36
164 0.29
165 0.25
166 0.22
167 0.21
168 0.18
169 0.15
170 0.15
171 0.17
172 0.19
173 0.16
174 0.12
175 0.13
176 0.13
177 0.13
178 0.14
179 0.13
180 0.09
181 0.09
182 0.1
183 0.12
184 0.14
185 0.15
186 0.15
187 0.19
188 0.24
189 0.27
190 0.3
191 0.27
192 0.32
193 0.35
194 0.34
195 0.31
196 0.32
197 0.33
198 0.31
199 0.36
200 0.33
201 0.36
202 0.38
203 0.4