Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2X6P5

Protein Details
Accession V2X6P5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
94-114GKFERMERRRANKQGIKERNFBasic
NLS Segment(s)
Subcellular Location(s) mito 26.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG mrr:Moror_14111  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSLLLQLALARRAPSTICTACRYRGYATKEGSGVAKQKHNIPQPKSSCPADTVLIGLNYLKGQEPVLAKPDEDYPEWLWTILRPKVIEDDGPGGKFERMERRRANKQGIKERNFLLTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.21
3 0.23
4 0.26
5 0.3
6 0.32
7 0.35
8 0.38
9 0.38
10 0.35
11 0.38
12 0.41
13 0.43
14 0.43
15 0.42
16 0.39
17 0.37
18 0.34
19 0.3
20 0.28
21 0.25
22 0.27
23 0.26
24 0.31
25 0.38
26 0.45
27 0.5
28 0.49
29 0.55
30 0.55
31 0.58
32 0.57
33 0.51
34 0.44
35 0.37
36 0.35
37 0.26
38 0.21
39 0.17
40 0.13
41 0.11
42 0.1
43 0.08
44 0.06
45 0.05
46 0.06
47 0.05
48 0.05
49 0.05
50 0.08
51 0.09
52 0.1
53 0.14
54 0.14
55 0.13
56 0.14
57 0.17
58 0.16
59 0.16
60 0.18
61 0.16
62 0.18
63 0.18
64 0.17
65 0.14
66 0.14
67 0.2
68 0.19
69 0.2
70 0.18
71 0.19
72 0.23
73 0.24
74 0.23
75 0.19
76 0.22
77 0.22
78 0.22
79 0.21
80 0.19
81 0.18
82 0.19
83 0.21
84 0.27
85 0.28
86 0.36
87 0.46
88 0.53
89 0.63
90 0.7
91 0.76
92 0.71
93 0.79
94 0.81
95 0.82
96 0.79
97 0.74
98 0.68