Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2Z0I5

Protein Details
Accession V2Z0I5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKSLRSKAKRDFRSKKREAGIYHydrophilic
NLS Segment(s)
PositionSequence
6-18RSKAKRDFRSKKR
85-128GPRGSRREEWRLSKGLSARPKSKGMNRQGGVAARRKAGRSKRRR
Subcellular Location(s) mito 13.5, mito_nucl 13.333, nucl 12, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG mrr:Moror_17668  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKAKRDFRSKKREAGIYAATHAARLRRLNARLSAVATRDAEGDVAVEDVEEEAADMPDSMQMDTTPIDAESSKRISTHGPRGSRREEWRLSKGLSARPKSKGMNRQGGVAARRKAGRSKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.86
4 0.82
5 0.78
6 0.7
7 0.65
8 0.6
9 0.51
10 0.46
11 0.4
12 0.33
13 0.28
14 0.26
15 0.22
16 0.2
17 0.21
18 0.24
19 0.28
20 0.31
21 0.35
22 0.37
23 0.38
24 0.35
25 0.35
26 0.33
27 0.26
28 0.26
29 0.22
30 0.19
31 0.16
32 0.14
33 0.12
34 0.09
35 0.08
36 0.05
37 0.05
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.02
44 0.02
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04
51 0.05
52 0.04
53 0.04
54 0.04
55 0.05
56 0.06
57 0.06
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.09
64 0.12
65 0.12
66 0.12
67 0.13
68 0.17
69 0.23
70 0.32
71 0.36
72 0.41
73 0.46
74 0.52
75 0.56
76 0.59
77 0.59
78 0.57
79 0.58
80 0.57
81 0.58
82 0.57
83 0.52
84 0.49
85 0.47
86 0.47
87 0.48
88 0.49
89 0.49
90 0.49
91 0.53
92 0.55
93 0.6
94 0.62
95 0.62
96 0.66
97 0.61
98 0.6
99 0.58
100 0.58
101 0.54
102 0.53
103 0.47
104 0.41
105 0.44
106 0.44
107 0.49
108 0.54